Germany
Japan
United Kingdom
China
Bhlhe41 (Myc-DDK-tagged) - Mouse basic helix-loop-helix family, member e41 (Bhlhe41)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadBHLHE41 (Myc-DDK-tagged)-Human basic helix-loop-helix family, member e41 (BHLHE41)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
2 Weeks
Lenti ORF particles, BHLHE41 (mGFP-tagged)-Human basic helix-loop-helix family, member e41 (BHLHE41), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, BHLHE41 (Myc-DDK-tagged)-Human basic helix-loop-helix family, member e41 (BHLHE41), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Bhlhe41 (GFP-tagged) - Mouse basic helix-loop-helix family member e41 (Bhlhe41), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BHLHE41 (GFP-tagged) - Human basic helix-loop-helix family, member e41 (BHLHE41)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, BHLHE41 (mGFP-tagged)-Human basic helix-loop-helix family, member e41 (BHLHE41), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
BHLHE41 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN406882 is the updated version of KN206882.
Bhlhe41 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN502160 is the updated version of KN302160.
Lenti ORF particles, Bhlhe41 (Myc-DDK-tagged) - Mouse basic helix-loop-helix family, member e41 (Bhlhe41), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, Bhlhe41 (GFP-tagged) - Mouse basic helix-loop-helix family, member e41 (Bhlhe41), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Bhlhe41 (myc-DDK-tagged) - Mouse basic helix-loop-helix family, member e41 (Bhlhe41), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of BHLHE41 (Myc-DDK-tagged)-Human basic helix-loop-helix family, member e41 (BHLHE41)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, BHLHE41 (Myc-DDK-tagged)-Human basic helix-loop-helix family, member e41 (BHLHE41), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Bhlhe41 (Myc-DDK-tagged) - Mouse basic helix-loop-helix family, member e41 (Bhlhe41)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
BHLHE41 (untagged)-Human basic helix-loop-helix family, member e41 (BHLHE41)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC310341 is the updated version of SC109802.
Lenti ORF clone of Bhlhe41 (mGFP-tagged) - Mouse basic helix-loop-helix family, member e41 (Bhlhe41)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Bhlhe41 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-BHLHB3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BHLHB3 Antibody: A synthesized peptide derived from human BHLHB3 |
BHLHE41 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of basic helix-loop-helix family, member e41 (BHLHE41)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-BHLHB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BHLHB3 Antibody: synthetic peptide directed towards the middle region of human BHLHB3. Synthetic peptide located within the following region: YCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTI |
BHLHE41 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
BHLHE41 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Bhlhe41 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI11B5 (formerly 11B5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI11F6 (formerly 11F6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI3A6 (formerly 3A6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
BHLHE41 CRISPRa kit - CRISPR gene activation of human basic helix-loop-helix family member e41
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Bhlhe41 CRISPRa kit - CRISPR gene activation of mouse basic helix-loop-helix family, member e41
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene BHLHB3
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene BHLHE41
Bhlhe41 (untagged) - Mouse basic helix-loop-helix family, member e41 (Bhlhe41), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Bhlhe41 (untagged) - Mouse basic helix-loop-helix family, member e41 (Bhlhe41), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Bhlhe41
Bhlhe41 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
Bhlhe41 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- BHLHE41