Products

View as table Download

Rabbit Polyclonal Anti-CaVAlpha2Delta4 (extracellular)

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)SERPQEMGRLLGEADG, corresponding to amino acid residues 881-896 of mouse Cava2d4. Extracellular.

Rabbit polyclonal anti-CACNA2D4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CACNA2D4.

Rabbit Polyclonal Anti-CACNA2D4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNA2D4 antibody is: synthetic peptide directed towards the middle region of Human CACNA2D4. Synthetic peptide located within the following region: ADLNHEFNESLVFDYYNSVLINERDEKGNFVELGAEFLLESNAHFSNLPV

Rabbit Polyclonal Anti-CACNA2D4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNA2D4 antibody: synthetic peptide directed towards the C terminal of human CACNA2D4. Synthetic peptide located within the following region: MAFLGTRAGLLRSSLFVGSEKVSDRKFLTPEDEASVFTLDRFPLWYRQAS

Cacna2d4 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

CACNA2D4 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CACNA2D4

CACNA2D4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 992-1115 of human CACNA2D4 (NP_758952.4).
Modifications Unmodified

CACNA2D4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 992-1115 of human CACNA2D4 (NP_758952.4).
Modifications Unmodified