Germany
Japan
United Kingdom
China
Products
View as table Download
Anti-CLU Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 230 amino acids of human clusterin |
Rabbit Polyclonal Anti-CLU Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLU antibody: synthetic peptide directed towards the C terminal of human CLU. Synthetic peptide located within the following region: CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN |
Rabbit Polyclonal Anti-CLU Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CLU |
Clusterin alpha chain Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-120 of human Clusterin alpha chain (NP_001822.3). |
| Modifications | Unmodified |
Clusterin alpha chain Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-449 of human Clusterin alpha chain (NP_976084.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CLU
Antibody Hosts
- Rabbit