Products

Jump to Filters
View as table Download
CNDP1 (C-term) Rabbit Polyclonal Antibody
AP50983PU-N

USD 512.00

2 Weeks

CNDP1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 422~451 amino acids from the C-terminal region of human CNDP1
CNDP1 Rabbit Polyclonal Antibody
TA343002

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNDP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNDP1 antibody: synthetic peptide directed towards the C terminal of human CNDP1. Synthetic peptide located within the following region: GSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFA
CNDP1 Rabbit Polyclonal Antibody
TA349814

USD 345.00

In Stock

Rabbit Polyclonal Anti-CNDP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CNDP1
CNDP1 Rabbit Polyclonal Antibody
TA374914

USD 220.00

3 Weeks

CNDP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human CNDP1 (NP_116038.4).
Modifications Unmodified