Products

View as table Download

CNDP1 (Myc-DDK-tagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, CNDP1 (Myc-DDK tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, CNDP1 (mGFP-tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Cndp1 (Myc-DDK-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Cndp1 (Myc-DDK-tagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CNDP1 (GFP-tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CNDP1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN410312 is the updated version of KN210312.

Cndp1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN503534 is the updated version of KN303534.

Cndp1 (GFP-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Cndp1 (Myc-DDK-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cndp1 (Myc-DDK-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Cndp1 (mGFP-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cndp1 (GFP-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CNDP1 (Myc-DDK tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CNDP1 (mGFP-tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Cndp1 (Myc-DDK-tagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cndp1 (Myc-DDK-tagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Cndp1 (mGFP-tagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cndp1 (GFP-tagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

CNDP1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 422~451 amino acids from the C-terminal region of human CNDP1

Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

CNDP1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CNDP1 (untagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SC322071 is the updated version of SC125389.

CNDP1 MS Standard C13 and N15-labeled recombinant protein (NP_116038)

Tag C-Myc/DDK
Expression Host HEK293

CNDP1 (untagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-CNDP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNDP1 antibody: synthetic peptide directed towards the C terminal of human CNDP1. Synthetic peptide located within the following region: GSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFA

CNDP1 (27-507, His-tag) human protein, 0.25 mg

Tag His-tag
Expression Host Insect

CNDP1 (27-507, His-tag) human protein, 50 µg

Tag His-tag
Expression Host Insect

Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

For quantitative detection of human CNDP1 in cell culture supernates, serum and plasma (heparin, EDTA).

Assay Type Sandwich ELISA kit of Quantitative Detection for Human CNDP1
Format 8x12 divisible strips
Reactivities Human

CNDP1 CRISPRa kit - CRISPR gene activation of human carnosine dipeptidase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Cndp1 CRISPRa kit - CRISPR gene activation of mouse carnosine dipeptidase 1 (metallopeptidase M20 family)

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene CNDP1

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene CNDP1

Cndp1 (untagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

qSTAR qPCR primer pairs against Mus musculus gene Cndp1

Cndp1 (untagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

3`UTR clone of carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

CNDP1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Cndp1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Rabbit Polyclonal Anti-CNDP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CNDP1

CNDP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human CNDP1 (NP_116038.4).
Modifications Unmodified

CNDP1 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated