Germany
Japan
United Kingdom
China
CNDP1 (Myc-DDK-tagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, CNDP1 (Myc-DDK tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CNDP1 (mGFP-tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Cndp1 (Myc-DDK-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Cndp1 (Myc-DDK-tagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CNDP1 (GFP-tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CNDP1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN410312 is the updated version of KN210312.
Cndp1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN503534 is the updated version of KN303534.
Cndp1 (GFP-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cndp1 (Myc-DDK-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cndp1 (Myc-DDK-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cndp1 (mGFP-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cndp1 (GFP-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CNDP1 (Myc-DDK tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CNDP1 (mGFP-tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cndp1 (Myc-DDK-tagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cndp1 (Myc-DDK-tagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cndp1 (mGFP-tagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cndp1 (GFP-tagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CNDP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CNDP1 (untagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SC322071 is the updated version of SC125389.
CNDP1 MS Standard C13 and N15-labeled recombinant protein (NP_116038)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CNDP1 (untagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CNDP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNDP1 antibody: synthetic peptide directed towards the C terminal of human CNDP1. Synthetic peptide located within the following region: GSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFA |
CNDP1 (27-507, His-tag) human protein, 0.25 mg
| Tag | His-tag |
| Expression Host | Insect |
CNDP1 (27-507, His-tag) human protein, 50 µg
| Tag | His-tag |
| Expression Host | Insect |
Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
For quantitative detection of human CNDP1 in cell culture supernates, serum and plasma (heparin, EDTA).
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human CNDP1 |
| Format | 8x12 divisible strips |
| Reactivities | Human |
CNDP1 CRISPRa kit - CRISPR gene activation of human carnosine dipeptidase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Cndp1 CRISPRa kit - CRISPR gene activation of mouse carnosine dipeptidase 1 (metallopeptidase M20 family)
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CNDP1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CNDP1
Transient overexpression lysate of carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Cndp1 (untagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Cndp1
Cndp1 (untagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
CNDP1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Cndp1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-CNDP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CNDP1 |
CNDP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human CNDP1 (NP_116038.4). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CNDP1