CNDP1 (Myc-DDK-tagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CNDP1 (Myc-DDK-tagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, CNDP1 (Myc-DDK tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CNDP1 (mGFP-tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Cndp1 (Myc-DDK-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Cndp1 (Myc-DDK-tagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CNDP1 (GFP-tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CNDP1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Cndp1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Cndp1 (GFP-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Cndp1 (Myc-DDK-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cndp1 (Myc-DDK-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Cndp1 (mGFP-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cndp1 (GFP-tagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CNDP1 (Myc-DDK tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CNDP1 (mGFP-tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Cndp1 (Myc-DDK-tagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cndp1 (Myc-DDK-tagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Cndp1 (mGFP-tagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cndp1 (GFP-tagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CNDP1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 422~451 amino acids from the C-terminal region of human CNDP1 |
Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CNDP1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CNDP1 (untagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CNDP1 MS Standard C13 and N15-labeled recombinant protein (NP_116038)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CNDP1 (untagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CNDP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNDP1 antibody: synthetic peptide directed towards the C terminal of human CNDP1. Synthetic peptide located within the following region: GSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFA |
CNDP1 (27-507, His-tag) human protein, 0.25 mg
Tag | His-tag |
Expression Host | Insect |
CNDP1 (27-507, His-tag) human protein, 50 µg
Tag | His-tag |
Expression Host | Insect |
Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
For quantitative detection of human CNDP1 in cell culture supernates, serum and plasma (heparin, EDTA).
Assay Type | Sandwich ELISA kit of Quantitative Detection for Human CNDP1 |
Format | 8x12 divisible strips |
Reactivities | Human |
CNDP1 CRISPRa kit - CRISPR gene activation of human carnosine dipeptidase 1
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Cndp1 CRISPRa kit - CRISPR gene activation of mouse carnosine dipeptidase 1 (metallopeptidase M20 family)
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CNDP1
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CNDP1
Transient overexpression lysate of carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Cndp1 (untagged) - Mouse carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Cndp1
Cndp1 (untagged ORF) - Rat carnosine dipeptidase 1 (metallopeptidase M20 family) (Cndp1), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
CNDP1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Cndp1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-CNDP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CNDP1 |
CNDP1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human CNDP1 (NP_116038.4). |
Modifications | Unmodified |
CNDP1 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |