Rabbit Polyclonal Anti-EIF4E2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF4E2 antibody: synthetic peptide directed towards the N terminal of human EIF4E2. Synthetic peptide located within the following region: KDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQY |
Rabbit Polyclonal Antibody against EIF4E2 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EIF4E2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-41 amino acids from the N-terminal region of human EIF4E2. |
EIF4E2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human EIF4E2 (NP_004837.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
