Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-ELF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELF1 Antibody: A synthesized peptide derived from human ELF1 |
Products
View as table Download
Rabbit Polyclonal anti-ELF1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELF1 antibody: synthetic peptide directed towards the N terminal of human ELF1. Synthetic peptide located within the following region: VTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATT |
Rabbit Polyclonal Anti-ELF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELF1 antibody: synthetic peptide directed towards the middle region of human ELF1. Synthetic peptide located within the following region: RSSQLVAHPPGTVITSVIKTQETKTLTQEVEKKESEDHLKENTEKTEQQP |
Rabbit Polyclonal Anti-ELF1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELF1 antibody: synthetic peptide directed towards the N terminal of mouse ELF1. Synthetic peptide located within the following region: DDIVAPITHVSVTLDGIPEVMETQQVQETNADSPGASSPEQRKRKKGRKT |
ELF1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ELF1 |
Active filters
Target Symbol
- ELF1
Antibody Hosts
- Rabbit