Germany
Japan
United Kingdom
China
ELF1 (Myc-DDK-tagged)-Human E74-like factor 1 (ets domain transcription factor) (ELF1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
ELF1 (GFP-tagged) - Human E74-like factor 1 (ets domain transcription factor) (ELF1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Purified recombinant protein of Human E74-like factor 1 (ets domain transcription factor) (ELF1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Elf1 (Myc-DDK-tagged) - Mouse E74-like factor 1 (Elf1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Elf1 (myc-DDK-tagged) - Mouse E74-like factor 1 (Elf1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ELF1 (Myc-DDK-tagged)-Human E74-like factor 1 (ets domain transcription factor) (ELF1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Elf1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN505146 is the updated version of KN305146.
Elf1 (GFP-tagged) - Mouse E74-like factor 1 (Elf1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Elf1 (Myc-DDK-tagged) - Mouse E74-like factor 1 (Elf1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Elf1 (Myc-DDK-tagged) - Mouse E74-like factor 1 (Elf1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Elf1 (mGFP-tagged) - Mouse E74-like factor 1 (Elf1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Elf1 (GFP-tagged) - Mouse E74-like factor 1 (Elf1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Elf1 (myc-DDK-tagged) - Mouse E74-like factor 1 (Elf1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human E74-like factor 1 (ets domain transcription factor) (ELF1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
6 Weeks
Lenti ORF particles, ELF1 (Myc-DDK tagged) - Human E74-like factor 1 (ets domain transcription factor) (ELF1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human E74-like factor 1 (ets domain transcription factor) (ELF1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
6 Weeks
Lenti ORF particles, ELF1 (mGFP-tagged) - Human E74-like factor 1 (ets domain transcription factor) (ELF1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ELF1 (Myc-DDK-tagged)-Human E74-like factor 1 (ets domain transcription factor) (ELF1), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
6 Weeks
Lenti ORF particles, ELF1 (Myc-DDK-tagged)-Human E74-like factor 1 (ets domain transcription factor) (ELF1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ELF1 (mGFP-tagged)-Human E74-like factor 1 (ets domain transcription factor) (ELF1), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
6 Weeks
Lenti ORF particles, ELF1 (mGFP-tagged)-Human E74-like factor 1 (ets domain transcription factor) (ELF1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ELF1 (GFP-tagged) - Human E74-like factor 1 (ets domain transcription factor) (ELF1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Elf1 (Myc-DDK-tagged ORF) - Rat E74-like factor 1 (Elf1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Elf1 (Myc-DDK-tagged ORF) - Rat E74-like factor 1 (Elf1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Elf1 (Myc-DDK-tagged ORF) - Rat E74-like factor 1 (Elf1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Elf1 (mGFP-tagged ORF) - Rat E74-like factor 1 (Elf1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Elf1 (GFP-tagged ORF) - Rat E74-like factor 1 (Elf1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ELF1 (untagged)-Human E74-like factor 1 (ets domain transcription factor) (ELF1), transcript variant 1
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ELF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELF1 Antibody: A synthesized peptide derived from human ELF1 |
ELF1 (untagged)-Human E74-like factor 1 (ets domain transcription factor) (ELF1), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Homo sapiens gene ELF1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
ELF1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ELF1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
ELF1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of E74-like factor 1 (ets domain transcription factor) (ELF1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal anti-ELF1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELF1 antibody: synthetic peptide directed towards the N terminal of human ELF1. Synthetic peptide located within the following region: VTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATT |
qPCR primer pairs and template standards against Homo sapiens gene ELF1
| Application | Plasmid of exact quantity for transcript copy number calculation |
Goat Polyclonal Antibody against ELF1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AMKQNELLEPNSF, from the C Terminus of the protein sequence according to NP_758961.1. |
Rabbit Polyclonal Anti-ELF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELF1 antibody: synthetic peptide directed towards the middle region of human ELF1. Synthetic peptide located within the following region: RSSQLVAHPPGTVITSVIKTQETKTLTQEVEKKESEDHLKENTEKTEQQP |
Rabbit Polyclonal Anti-ELF1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELF1 antibody: synthetic peptide directed towards the N terminal of mouse ELF1. Synthetic peptide located within the following region: DDIVAPITHVSVTLDGIPEVMETQQVQETNADSPGASSPEQRKRKKGRKT |
Carrier-free (BSA/glycerol-free) ELF1 mouse monoclonal antibody,clone OTI4F4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELF1 mouse monoclonal antibody,clone OTI3G7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELF1 mouse monoclonal antibody,clone OTI1H1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELF1 mouse monoclonal antibody,clone OTI2G9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ELF1 CRISPRa kit - CRISPR gene activation of human E74 like ETS transcription factor 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Elf1 CRISPRa kit - CRISPR gene activation of mouse E74-like factor 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Elf1 (untagged) - Mouse E74-like factor 1 (Elf1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Elf1 (untagged) - Mouse E74-like factor 1 (Elf1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- ELF1