Products

Jump to Filters
View as table Download
Galanin (GAL) Rabbit Polyclonal Antibody
TA371800

USD 380.00

4 Weeks

GAL rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GAL
Galanin (GAL) (Center) Rabbit Polyclonal Antibody
AP51760PU-N

USD 450.00

2 Weeks

Galanin (GAL) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 55-86 amino acids from the Central region of human GAL
Galanin (GAL) Rabbit Polyclonal Antibody
TA364094

USD 400.00

2 Weeks

Rabbit polyclonal anti human Galanin

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu- Thr-Ser-OH coupled to carrier protein.
Galanin (GAL) Rabbit Polyclonal Antibody
TA330441

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-GAL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAL antibody: synthetic peptide directed towards the middle region of human GAL. Synthetic peptide located within the following region: LNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENN
Galanin (GAL) Rabbit Polyclonal Antibody
TA364085

USD 690.00

2 Weeks

Rabbit polyclonal anti Galanin (hu); diluted antiserum

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu- Thr-Ser-OH coupled to carrier protein.
Galanin (GAL) Rabbit Polyclonal Antibody
TA364093

USD 655.00

2 Weeks

Rabbit polyclonal anti Galanin (hu); purified rabbit IgG

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu- Thr-Ser-OH coupled to carrier protein.
GAL Rabbit Polyclonal Antibody
TA364095

USD 655.00

2 Weeks

Rabbit polyclonal anti Galanin (po); purified rabbit IgG

Applications ELISA
Reactivities Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein.
GAL Rabbit Polyclonal Antibody
TA364096

USD 690.00

2 Weeks

Rabbit polyclonal anti Galanin (po); diluted antiserum

Applications ELISA
Reactivities Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein.
GAL Rabbit Polyclonal Antibody
TA364098

USD 400.00

2 Weeks

Rabbit polyclonal anti Galanin (po); neat antiserum

Applications ELISA
Reactivities Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein.
Gal Rabbit Polyclonal Antibody
TA364099

USD 690.00

2 Weeks

Rabbit polyclonal anti Galanin (ms, rt); diluted antiserum

Applications ELISA
Reactivities Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr- NH2 coupled to carrier protein.
Gal Rabbit Polyclonal Antibody
TA364101

USD 655.00

2 Weeks

Rabbit polyclonal anti Galanin (ms, rt); purified rabbit IgG

Applications ELISA
Reactivities Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr- NH2 coupled to a carrier protein.
GAL Rabbit Polyclonal Antibody
TA367574

USD 380.00

4 Weeks

GAL rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GAL