Products

cDNA Clones (25)
Antibodies (17)
Gene Expression (11)
RNAi (11)
Proteins (10)
Assay Kits (1)
Jump to Filters
View as table Download
Galanin (GAL) (NM_015973) Human Recombinant Protein
TP307053

USD 439.00

In Stock

Recombinant protein of human galanin prepropeptide (GAL)

Tag C-Myc/DDK
Expression Host HEK293T
Gal (NM_010253) Mouse Tagged ORF Clone
MR225635

USD 68.00

USD 390.00

In Stock

Gal (Myc-DDK-tagged) - Mouse galanin (Gal)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Galanin (GAL) (NM_015973) Human Tagged ORF Clone
RG207053

USD 460.00

In Stock

GAL (GFP-tagged) - Human galanin prepropeptide (GAL)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Galanin (GAL) Human Gene Knockout Kit (CRISPR)
KN407053

USD 1,290.00

2 Weeks

GAL - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN407053 is the updated version of KN207053.
Gal Mouse Gene Knockout Kit (CRISPR)
KN506263

USD 1,290.00

2 Weeks

Gal - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN506263 is the updated version of KN306263.
Gal (NM_010253) Mouse Tagged ORF Clone
MG225635

USD 300.00

3 Weeks

Gal (GFP-tagged) - Mouse galanin (Gal), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gal (NM_010253) Mouse Tagged ORF Clone
MR225635L3

USD 500.00

3 Weeks

Lenti ORF clone of Gal (Myc-DDK-tagged) - Mouse galanin (Gal)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gal (NM_010253) Mouse Tagged ORF Clone
MR225635L4

USD 500.00

3 Weeks

Lenti ORF clone of Gal (mGFP-tagged) - Mouse galanin (Gal)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Galanin (GAL) (NM_015973) Human Tagged ORF Clone
RC207053L3

USD 620.00

3 Weeks

Lenti ORF clone of Human galanin prepropeptide (GAL), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Galanin (GAL) (NM_015973) Human Tagged ORF Clone
RC207053L4

USD 620.00

3 Weeks

Lenti ORF clone of Human galanin prepropeptide (GAL), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gal (NM_033237) Rat Tagged ORF Clone
RR214394

USD 420.00

3 Weeks

Gal (Myc-DDK-tagged ORF) - Rat galanin prepropeptide (Gal), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gal (NM_033237) Rat Tagged ORF Clone
RR214394L3

USD 640.00

7 Weeks

Lenti ORF clone of Gal (Myc-DDK-tagged ORF) - Rat galanin prepropeptide (Gal), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gal (NM_033237) Rat Tagged ORF Clone Lentiviral Particle
RR214394L3V

USD 850.00

11 Weeks

Lenti ORF particles, Gal (Myc-DDK-tagged ORF) - Rat galanin prepropeptide (Gal), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gal (NM_033237) Rat Tagged ORF Clone
RR214394L4

USD 700.00

7 Weeks

Lenti ORF clone of Gal (mGFP-tagged ORF) - Rat galanin prepropeptide (Gal), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gal (NM_033237) Rat Tagged ORF Clone Lentiviral Particle
RR214394L4V

USD 960.00

11 Weeks

Lenti ORF particles, Gal (GFP-tagged ORF) - Rat galanin prepropeptide (Gal), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Galanin (GAL) Rabbit Polyclonal Antibody
TA371800

USD 380.00

4 Weeks

GAL rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GAL
Galanin (GAL) (NM_015973) Human Untagged Clone
SC122834

USD 310.00

In Stock

GAL (untagged)-Human galanin prepropeptide (GAL)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Galanin (GAL) (Center) Rabbit Polyclonal Antibody
AP51760PU-N

USD 450.00

2 Weeks

Galanin (GAL) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 55-86 amino acids from the Central region of human GAL
Galanin (GAL) Rabbit Polyclonal Antibody
TA364094

USD 400.00

2 Weeks

Rabbit polyclonal anti human Galanin

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu- Thr-Ser-OH coupled to carrier protein.
Galanin (GAL) Guinea Pig Polyclonal Antibody
TA364389

USD 545.00

2 Weeks

Guinea pig polyclonal anti Galanin (hu); neat antiserum

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu- Thr-Ser-OH coupled to carrier protein.
Galanin (GAL) (NM_015973) Human Tagged ORF Clone
RC207053L1

USD 620.00

In Stock

Lenti ORF clone of Human galanin prepropeptide (GAL), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Galanin (GAL) (NM_015973) Human Tagged ORF Clone
RC207053L2

USD 620.00

3 Weeks

Lenti ORF clone of Human galanin prepropeptide (GAL), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Galanin (GAL) Goat Polyclonal Antibody
TA311451

USD 375.00

2 Weeks

Goat Anti-GAL Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-HRSFSDKNGLTSK, from the internal region of the protein sequence according to NP_057057.2.
Galanin (GAL) Rabbit Polyclonal Antibody
TA330441

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-GAL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAL antibody: synthetic peptide directed towards the middle region of human GAL. Synthetic peptide located within the following region: LNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENN
Gal Mouse shRNA Plasmid (Locus ID 14419)
TL513561

USD 815.00

In Stock

Gal - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
Galanin (GAL) (NM_015973) Human Over-expression Lysate
LC402479

USD 121.00

In Stock

GAL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Galanin (GAL) Human Gene Knockout Kit (CRISPR)
KN207053

USD 1,290.00

2 Weeks

GAL - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA GFP-puro
Galanin (GAL) Rabbit Polyclonal Antibody
TA364085

USD 690.00

2 Weeks

Rabbit polyclonal anti Galanin (hu); diluted antiserum

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu- Thr-Ser-OH coupled to carrier protein.
Galanin (GAL) Rabbit Polyclonal Antibody
TA364093

USD 655.00

2 Weeks

Rabbit polyclonal anti Galanin (hu); purified rabbit IgG

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu- Thr-Ser-OH coupled to carrier protein.
GAL Rabbit Polyclonal Antibody
TA364095

USD 655.00

2 Weeks

Rabbit polyclonal anti Galanin (po); purified rabbit IgG

Applications ELISA
Reactivities Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein.
GAL Rabbit Polyclonal Antibody
TA364096

USD 690.00

2 Weeks

Rabbit polyclonal anti Galanin (po); diluted antiserum

Applications ELISA
Reactivities Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein.
GAL Rabbit Polyclonal Antibody
TA364098

USD 400.00

2 Weeks

Rabbit polyclonal anti Galanin (po); neat antiserum

Applications ELISA
Reactivities Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein.
Gal Rabbit Polyclonal Antibody
TA364099

USD 690.00

2 Weeks

Rabbit polyclonal anti Galanin (ms, rt); diluted antiserum

Applications ELISA
Reactivities Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr- NH2 coupled to carrier protein.
Gal Rabbit Polyclonal Antibody
TA364101

USD 655.00

2 Weeks

Rabbit polyclonal anti Galanin (ms, rt); purified rabbit IgG

Applications ELISA
Reactivities Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr- NH2 coupled to a carrier protein.
GAL Guinea Pig Polyclonal Antibody
TA364388

USD 965.00

2 Weeks

Guinea pig polyclonal anti Galanin (po); diluted antiserum

Applications ELISA
Reactivities Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein.
GAL Guinea Pig Polyclonal Antibody
TA364390

USD 545.00

2 Weeks

Guinea pig polyclonal anti Galanin (porcine) , neat antiserum

Applications ELISA
Reactivities Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein.
Galanin (GAL) Human shRNA Lentiviral Particle (Locus ID 51083)
TL319569V

USD 1,731.00

5 Weeks

GAL - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
Galanin (20-123, His-tag) Human Protein
AR50878PU-N

USD 845.00

2 Weeks

Galanin (20-123, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
Galanin (20-123, His-tag) Human Protein
AR50878PU-S

USD 330.00

2 Weeks

Galanin (20-123, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Human Galanin (GAL) activation kit by CRISPRa
GA109548

USD 1,290.00

2 Weeks

GAL CRISPRa kit - CRISPR gene activation of human galanin and GMAP prepropeptide

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Gal activation kit by CRISPRa
GA201531

USD 1,290.00

2 Weeks

Gal CRISPRa kit - CRISPR gene activation of mouse galanin and GMAP prepropeptide

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
GAL Human qPCR Template Standard (NM_015973)
HK203258

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene GAL

Application Plasmid of exact quantity for transcript copy number calculation