Vitamin D Binding protein (GC) rabbit polyclonal antibody
Applications | ELISA, IHC |
Reactivities | Human |
Immunogen | Native human vitamin D binding protein |
Vitamin D Binding protein (GC) rabbit polyclonal antibody
Applications | ELISA, IHC |
Reactivities | Human |
Immunogen | Native human vitamin D binding protein |
Rabbit Polyclonal Anti-GC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GC antibody: synthetic peptide directed towards the N terminal of human GC. Synthetic peptide located within the following region: KHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLV |
Anti-GC Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 217-474 amino acids of human group-specific component (vitamin D binding protein) |
Anti-GC Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 217-474 amino acids of human group-specific component (vitamin D binding protein) |
GC Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 324-493 of human GC (NP_001191236.1). |
Modifications | Unmodified |