Products

cDNA Clones (31)
Antibodies (21)
Proteins (18)
RNAi (12)
Gene Expression (7)
Assay Kits (1)
Jump to Filters
View as table Download
Vitamin D Binding protein (GC) (NM_000583) Human Recombinant Protein
TP308864

USD 823.00

In Stock

Recombinant protein of human group-specific component (vitamin D binding protein) (GC)

Tag C-Myc/DDK
Expression Host HEK293T
Gc (NM_008096) Mouse Tagged ORF Clone
MR207634

USD 500.00

In Stock

Gc (Myc-DDK-tagged) - Mouse group specific component (Gc)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Vitamin D Binding protein (GC) (NM_000583) Human Tagged ORF Clone
RG208864

USD 460.00

In Stock

GC (GFP-tagged) - Human group-specific component (vitamin D binding protein) (GC), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Vitamin D Binding protein (GC) (NM_001204306) Human Tagged ORF Clone
RC232807

USD 420.00

In Stock

GC (Myc-DDK tagged) - Homo sapiens group-specific component (vitamin D binding protein) (GC), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gc Mouse Gene Knockout Kit (CRISPR)
KN506353

USD 1,290.00

2 Weeks

Gc - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN506353 is the updated version of KN306353.
Gc (NM_008096) Mouse Tagged ORF Clone
MG207634

USD 550.00

3 Weeks

Gc (GFP-tagged) - Mouse group specific component (Gc)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gc (NM_008096) Mouse Tagged ORF Clone
MR207634L3

USD 700.00

3 Weeks

Lenti ORF clone of Gc (Myc-DDK-tagged) - Mouse group specific component (Gc)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gc (NM_008096) Mouse Tagged ORF Clone Lentiviral Particle
MR207634L3V

USD 900.00

6 Weeks

Lenti ORF particles, Gc (Myc-DDK-tagged) - Mouse group specific component (Gc), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gc (NM_008096) Mouse Tagged ORF Clone
MR207634L4

USD 700.00

3 Weeks

Lenti ORF clone of Gc (mGFP-tagged) - Mouse group specific component (Gc)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gc (NM_008096) Mouse Tagged ORF Clone Lentiviral Particle
MR207634L4V

USD 900.00

6 Weeks

Lenti ORF particles, Gc (GFP-tagged) - Mouse group specific component (Gc), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Vitamin D Binding protein (GC) (NM_000583) Human Tagged ORF Clone Lentiviral Particle
RC208864L3V

USD 820.00

5 Weeks

Lenti ORF particles, GC (Myc-DDK tagged) - Human group-specific component (vitamin D binding protein) (GC), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Vitamin D Binding protein (GC) (NM_000583) Human Tagged ORF Clone Lentiviral Particle
RC208864L4V

USD 820.00

7 Weeks

Lenti ORF particles, GC (mGFP-tagged) - Human group-specific component (vitamin D binding protein) (GC), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Vitamin D Binding protein (GC) (NM_001204307) Human Tagged ORF Clone
RC232853

USD 520.00

2 Weeks

GC (Myc-DDK tagged) - Homo sapiens group-specific component (vitamin D binding protein) (GC), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Vitamin D Binding protein (GC) (NM_001204306) Human Tagged ORF Clone
RG232807

USD 460.00

3 Weeks

GC (GFP-tagged) - Homo sapiens group-specific component (vitamin D binding protein) (GC), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Vitamin D Binding protein (GC) (NM_001204307) Human Tagged ORF Clone
RG232853

USD 570.00

3 Weeks

GC (GFP-tagged) - Homo sapiens group-specific component (vitamin D binding protein) (GC), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gc (NM_012564) Rat Tagged ORF Clone
RR213014

USD 650.00

4 Weeks

Gc (Myc-DDK-tagged ORF) - Rat group specific component (Gc), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gc (NM_012564) Rat Tagged ORF Clone
RR213014L3

USD 840.00

9 Weeks

Lenti ORF clone of Gc (Myc-DDK-tagged ORF) - Rat group specific component (Gc), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gc (NM_012564) Rat Tagged ORF Clone Lentiviral Particle
RR213014L3V

USD 1,060.00

13 Weeks

Lenti ORF particles, Gc (Myc-DDK-tagged ORF) - Rat group specific component (Gc), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gc (NM_012564) Rat Tagged ORF Clone
RR213014L4

USD 930.00

9 Weeks

Lenti ORF clone of Gc (mGFP-tagged ORF) - Rat group specific component (Gc), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gc (NM_012564) Rat Tagged ORF Clone Lentiviral Particle
RR213014L4V

USD 1,190.00

13 Weeks

Lenti ORF particles, Gc (GFP-tagged ORF) - Rat group specific component (Gc), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Vitamin D Binding protein (GC) (NM_000583) Human Tagged ORF Clone
RC208864L1

USD 768.00

In Stock

Lenti ORF clone of Human group-specific component (vitamin D binding protein) (GC), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Vitamin D Binding protein (GC) (NM_000583) Human Untagged Clone
SC119806

USD 310.00

In Stock

GC (untagged)-Human group-specific component (vitamin D binding protein) (GC), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Gc (NM_008096) Mouse Untagged Clone
MC204854

USD 210.00

In Stock

Gc (untagged) - Mouse group specific component (Gc), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Vitamin D Binding protein (GC) Goat Polyclonal Antibody
TA302630

USD 375.00

In Stock

Goat Polyclonal Antibody against Vitamin D-binding protein / GC

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CDNLSTKNSKFED, from the internal region of the protein sequence according to NP_000574.2.
Vitamin D Binding protein (GC) (NM_000583) Human Mass Spec Standard
PH308864

USD 2,055.00

2 Weeks

GC MS Standard C13 and N15-labeled recombinant protein (NP_000574)

Tag C-Myc/DDK
Expression Host HEK293
Vitamin D Binding protein (GC) (NM_000583) Human Tagged ORF Clone
RC208864L2

USD 620.00

3 Weeks

Lenti ORF clone of Human group-specific component (vitamin D binding protein) (GC), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GC Human siRNA Oligo Duplex (Locus ID 2638)
SR301756

USD 430.00

In Stock

GC (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Vitamin D Binding protein (GC) (NM_000583) Human Recombinant Protein
TP720729

USD 330.00

3 Weeks

Purified recombinant protein of Human group-specific component (vitamin D binding protein) (GC), transcript variant 1

Tag C-His
Expression Host HEK293
Gc Mouse shRNA Plasmid (Locus ID 14473)
TR500779

USD 715.00

In Stock

Gc - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
Vitamin D Binding protein (GC) Rabbit Polyclonal Antibody
AP23593PU-N

USD 440.00

2 Weeks

Vitamin D Binding protein (GC) rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human
Immunogen Native human vitamin D binding protein
Vitamin D Binding protein (GC) Human qPCR Primer Pair (NM_000583)
HP200550

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene GC

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Vitamin D Binding protein (GC) Rabbit Polyclonal Antibody
TA343119

USD 375.00

5 Days

Rabbit Polyclonal Anti-GC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GC antibody: synthetic peptide directed towards the N terminal of human GC. Synthetic peptide located within the following region: KHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLV
Vitamin D-binding Human Protein
BA1080

USD 290.00

5 Days

Vitamin D-binding protein human protein, 1 mg

Protein Source Plasma
Vitamin D Binding protein (GC) Mouse Monoclonal Antibody [Clone ID: OTI8C5]
CF809265

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GC mouse monoclonal antibody,clone OTI8C5

Applications WB
Reactivities Human
Conjugation Unconjugated
Mouse Gc ELISA KIT (1 x 96 wells)
EA102740

USD 435.00

3 Weeks

For quantitative detection of mouse Vitamin DBP in cell culture supernates, lysates, serum, plasma (heparin) and urine.

Assay Type Sandwich ELISA kit of Quantitative Detection for Mouse Vitamin DBP
Format 8x12 divisible strips
Reactivities Mouse
Human Vitamin D Binding protein (GC) activation kit by CRISPRa
GA101758

USD 1,290.00

2 Weeks

GC CRISPRa kit - CRISPR gene activation of human GC vitamin D binding protein

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Gc activation kit by CRISPRa
GA201562

USD 1,290.00

2 Weeks

Gc CRISPRa kit - CRISPR gene activation of mouse vitamin D binding protein

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Vitamin D Binding protein (GC) Human qPCR Template Standard (NM_000583)
HK203293

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene GC

Application Plasmid of exact quantity for transcript copy number calculation
Gc Mouse qPCR Template Standard (NM_008096)
MK204057

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Gc

Application Plasmid of exact quantity for transcript copy number calculation
Gc Mouse qPCR Primer Pair (NM_008096)
MP205755

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Gc

Gc (NM_012564) Rat Untagged Clone
RN213014

USD 650.00

5 Weeks

Gc (untagged ORF) - Rat group specific component (Gc), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin