Products

View as table Download

Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region

Applications WB
Reactivities Rat, Tobacco hornworm
Conjugation Unconjugated
Immunogen The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL

Anti-MAPK10 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 416-428 amino acids of Human mitogen-activated protein kinase 10

MAPK10 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAPK10

Rabbit polyclonal anti-MAPK10 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MAPK10.

JNK3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human JNK3.
Modifications Unmodified