MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, MAPK10 (Myc-DDK tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, MAPK10 (mGFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Mapk10 (GFP-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10) transcript variant 1, (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Mapk10 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Mapk10 (Myc-DDK-tagged ORF) - Rat mitogen activated protein kinase 10 (Mapk10), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Mapk10 (GFP-tagged) - Mouse mitogen activated protein kinase 10 (Mapk10), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MAPK10 (GFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MAPK10 (GFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Mapk10 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Mapk10 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Mapk10 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Mapk10 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Mapk10 (mGFP-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Mapk10 (GFP-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Mapk10 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Mapk10 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Mapk10 (mGFP-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Mapk10 (GFP-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAPK10 (Myc-DDK tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAPK10 (mGFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MAPK10 (GFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Mapk10 (Myc-DDK-tagged ORF) - Rat mitogen activated protein kinase 10 (Mapk10), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Mapk10 (Myc-DDK-tagged ORF) - Rat mitogen activated protein kinase 10 (Mapk10), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Mapk10 (mGFP-tagged ORF) - Rat mitogen activated protein kinase 10 (Mapk10), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Mapk10 (GFP-tagged ORF) - Rat mitogen activated protein kinase 10 (Mapk10), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Mapk10 (myc-DDK-tagged) - Rat mitogen activated protein kinase 10 (Mapk10), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MAPK10 (untagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
MAPK10 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
Applications | WB |
Reactivities | Rat, Tobacco hornworm |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
Transient overexpression lysate of mitogen-activated protein kinase 10 (MAPK10), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Recombinant protein of human mitogen-activated protein kinase 10 (MAPK10), transcript variant 4, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
MAPK10 (untagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Mapk10 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
MAPK10 (untagged)-Kinase deficient mutant (K93M) of Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |