Germany
Japan
United Kingdom
China
MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, MAPK10 (Myc-DDK tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, MAPK10 (mGFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Mapk10 (GFP-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10) transcript variant 1, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Mapk10 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Mapk10 (Myc-DDK-tagged ORF) - Rat mitogen activated protein kinase 10 (Mapk10), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Mapk10 (GFP-tagged) - Mouse mitogen activated protein kinase 10 (Mapk10), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAPK10 (GFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAPK10 (GFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Mapk10 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN509756 is the updated version of KN309756.
Mapk10 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Mapk10 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mapk10 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mapk10 (mGFP-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mapk10 (GFP-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mapk10 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mapk10 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mapk10 (mGFP-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mapk10 (GFP-tagged) - Mouse mitogen-activated protein kinase 10 (Mapk10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MAPK10 (Myc-DDK tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MAPK10 (mGFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MAPK10 (GFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Mapk10 (Myc-DDK-tagged ORF) - Rat mitogen activated protein kinase 10 (Mapk10), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mapk10 (Myc-DDK-tagged ORF) - Rat mitogen activated protein kinase 10 (Mapk10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mapk10 (mGFP-tagged ORF) - Rat mitogen activated protein kinase 10 (Mapk10), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mapk10 (GFP-tagged ORF) - Rat mitogen activated protein kinase 10 (Mapk10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Mapk10 (myc-DDK-tagged) - Rat mitogen activated protein kinase 10 (Mapk10), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAPK10 (untagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MAPK10 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat, Tobacco hornworm |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
Transient overexpression lysate of mitogen-activated protein kinase 10 (MAPK10), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Recombinant protein of human mitogen-activated protein kinase 10 (MAPK10), transcript variant 4, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
MAPK10 (untagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Mapk10 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
MAPK10 (untagged)-Kinase deficient mutant (K93M) of Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Active filters
Target Symbol
- MAPK10
Filter by
Species
Reactivities
Antibody Hosts
Clonalities
Conjugates
Expression Hosts
Lentivirus
Vectors
Modifications
QC Levels
Mammalian Cell Selection
Families
Pathways
- Adipocytokine signaling pathway (64)
- Colorectal cancer (64)
- Epithelial cell signaling in Helicobacter pylori infection (64)
- ErbB signaling pathway (64)
- Fc epsilon RI signaling pathway (64)
- Focal adhesion (64)
- GnRH signaling pathway (64)
- Insulin signaling pathway (64)
- MAPK signaling pathway (64)
- NOD-like receptor signaling pathway (64)
- Neurotrophin signaling pathway (64)
- Pancreatic cancer (64)
- Pathways in cancer (64)
- Progesterone-mediated oocyte maturation (64)
- RIG-I-like receptor signaling pathway (64)
- Toll-like receptor signaling pathway (64)
- Type II diabetes mellitus (64)
- Wnt signaling pathway (64)