Products

View as table Download

Rabbit Polyclonal Anti-PCCA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCCA Antibody: synthetic peptide directed towards the N terminal of human PCCA. Synthetic peptide located within the following region: LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI

PCCA (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 336-365 amino acids from the Central region of human PCCA

PCCA Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 449-728 of human PCCA (NP_000273.2).
Modifications Unmodified