Products

Jump to Filters
View as table Download
MGC13096 (PDCD2L) Rabbit Polyclonal Antibody
TA339771

USD 375.00

5 Days

Rabbit Polyclonal Anti-PDCD2L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDCD2L antibody: synthetic peptide directed towards the N terminal of human PDCD2L. Synthetic peptide located within the following region: FACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGA
MGC13096 (PDCD2L) Rabbit Polyclonal Antibody
TA379716

USD 220.00

3 Weeks

PDCD2L Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-358 of human PDCD2L (NP_115722.1).
Modifications Unmodified