Germany
Japan
United Kingdom
China
PDCD2L (Myc-DDK-tagged)-Human programmed cell death 2-like (PDCD2L)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human programmed cell death 2-like (PDCD2L)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Pdcd2l (Myc-DDK-tagged) - Mouse programmed cell death 2-like (Pdcd2l)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDCD2L (GFP-tagged) - Human programmed cell death 2-like (PDCD2L)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDCD2L - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN402997 is the updated version of KN202997.
Pdcd2l - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN512995 is the updated version of KN312995.
Pdcd2l (GFP-tagged) - Mouse programmed cell death 2-like (Pdcd2l), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pdcd2l (Myc-DDK-tagged) - Mouse programmed cell death 2-like (Pdcd2l)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pdcd2l (Myc-DDK-tagged) - Mouse programmed cell death 2-like (Pdcd2l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pdcd2l (mGFP-tagged) - Mouse programmed cell death 2-like (Pdcd2l)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pdcd2l (GFP-tagged) - Mouse programmed cell death 2-like (Pdcd2l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human programmed cell death 2-like (PDCD2L), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PDCD2L (Myc-DDK tagged) - Human programmed cell death 2-like (PDCD2L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human programmed cell death 2-like (PDCD2L), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PDCD2L (mGFP-tagged) - Human programmed cell death 2-like (PDCD2L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Pdcd2l (Myc-DDK-tagged ORF) - Rat programmed cell death 2-like (Pdcd2l), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pdcd2l (Myc-DDK-tagged ORF) - Rat programmed cell death 2-like (Pdcd2l), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pdcd2l (Myc-DDK-tagged ORF) - Rat programmed cell death 2-like (Pdcd2l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pdcd2l (mGFP-tagged ORF) - Rat programmed cell death 2-like (Pdcd2l), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pdcd2l (GFP-tagged ORF) - Rat programmed cell death 2-like (Pdcd2l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PDCD2L (untagged)-Human programmed cell death 2-like (PDCD2L)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PDCD2L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDCD2L antibody: synthetic peptide directed towards the N terminal of human PDCD2L. Synthetic peptide located within the following region: FACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGA |
PDCD2L CRISPRa kit - CRISPR gene activation of human programmed cell death 2 like
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Pdcd2l CRISPRa kit - CRISPR gene activation of mouse programmed cell death 2-like
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PDCD2L
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene PDCD2L
PDCD2L HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of programmed cell death 2-like (PDCD2L)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Pdcd2l (untagged) - Mouse programmed cell death 2-like (Pdcd2l), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Pdcd2l
PDCD2L MS Standard C13 and N15-labeled recombinant protein (NP_115722)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Pdcd2l (untagged ORF) - Rat programmed cell death 2-like (Pdcd2l), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Pdcd2l (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
PDCD2L Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-358 of human PDCD2L (NP_115722.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- PDCD2L