Products

View as table Download

Rabbit Polyclonal Anti-VGLL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VGLL1 antibody: synthetic peptide directed towards the N terminal of human VGLL1. Synthetic peptide located within the following region: LFTYFQGDISSVVDEHFSRALSNIKSPQELTPSSQSEGVMLKNDDSMSPN

Rabbit Polyclonal Anti-VGLL1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VGLL1 antibody: synthetic peptide directed towards the middle region of human VGLL1. Synthetic peptide located within the following region: RPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNE

VGLL1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 59-258 of human VGLL1 (NP_057351.1).
Modifications Unmodified

VGLL1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 59-258 of human VGLL1 (NP_057351.1).
Modifications Unmodified

Anti-VGLL1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 62-75 amino acids of human vestigial like 1 (Drosophila)

Vgll1 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Vgll1