Products

View as table Download

Rabbit Polyclonal Anti-VSIG8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-VSIG8 Antibody: synthetic peptide directed towards the N terminal of human VSIG8. Synthetic peptide located within the following region: HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT

VSIG8 (C1orf204) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 338-368 amino acids from the C-terminal region of human VSIG8

Rabbit Polyclonal Anti-VSIG8 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human VSIG8

VSIG8 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human VSIG8