Germany
Japan
United Kingdom
China
VSIG8 (Myc-DDK-tagged)-Human V-set and immunoglobulin domain containing 8 (VSIG8)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Vsig8 (Myc-DDK-tagged) - Mouse V-set and immunoglobulin domain containing 8 (Vsig8), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Vsig8 (Myc-DDK-tagged) - Mouse V-set and immunoglobulin domain containing 8 (cDNA clone MGC:73808 IMAGE:1528324)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
VSIG8 (GFP-tagged) - Human V-set and immunoglobulin domain containing 8 (VSIG8)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
VSIG8 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN412118 is the updated version of KN212118.
Vsig8 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN519279 is the updated version of KN319279.
Vsig8 (GFP-tagged) - Mouse V-set and immunoglobulin domain containing 8 (cDNA clone MGC:73808 IMAGE:1528324)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Vsig8 (GFP-tagged) - Mouse V-set and immunoglobulin domain containing 8 (Vsig8) transcript variant 1, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Vsig8 (Myc-DDK-tagged) - Mouse V-set and immunoglobulin domain containing 8 (cDNA clone MGC:73808 IMAGE:1528324)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Vsig8 (Myc-DDK-tagged) - Mouse V-set and immunoglobulin domain containing 8 (cDNA clone MGC:73808 IMAGE:1528324), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Vsig8 (mGFP-tagged) - Mouse V-set and immunoglobulin domain containing 8 (cDNA clone MGC:73808 IMAGE:1528324)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Vsig8 (GFP-tagged) - Mouse V-set and immunoglobulin domain containing 8 (cDNA clone MGC:73808 IMAGE:1528324), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Vsig8 (Myc-DDK-tagged) - Mouse V-set and immunoglobulin domain containing 8 (Vsig8), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Vsig8 (Myc-DDK-tagged) - Mouse V-set and immunoglobulin domain containing 8 (Vsig8), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Vsig8 (mGFP-tagged) - Mouse V-set and immunoglobulin domain containing 8 (Vsig8), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Vsig8 (GFP-tagged) - Mouse V-set and immunoglobulin domain containing 8 (Vsig8), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human V-set and immunoglobulin domain containing 8 (VSIG8), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, VSIG8 (Myc-DDK tagged) - Human V-set and immunoglobulin domain containing 8 (VSIG8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human V-set and immunoglobulin domain containing 8 (VSIG8), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, VSIG8 (mGFP-tagged) - Human V-set and immunoglobulin domain containing 8 (VSIG8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Vsig8 (Myc-DDK-tagged ORF) - Rat similar to hypothetical protein A030011M19 (RGD1562464), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Vsig8 (Myc-DDK-tagged ORF) - Rat similar to hypothetical protein A030011M19 (RGD1562464), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Vsig8 (Myc-DDK-tagged ORF) - Rat similar to hypothetical protein A030011M19 (RGD1562464), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Vsig8 (mGFP-tagged ORF) - Rat similar to hypothetical protein A030011M19 (RGD1562464), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Vsig8 (GFP-tagged ORF) - Rat similar to hypothetical protein A030011M19 (RGD1562464), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
VSIG8 (untagged)-Human V-set and immunoglobulin domain containing 8 (VSIG8)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-VSIG8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-VSIG8 Antibody: synthetic peptide directed towards the N terminal of human VSIG8. Synthetic peptide located within the following region: HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT |
Transient overexpression lysate of V-set and immunoglobulin domain containing 8 (VSIG8)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Vsig8 - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
VSIG8 CRISPRa kit - CRISPR gene activation of human V-set and immunoglobulin domain containing 8
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Vsig8 CRISPRa kit - CRISPR gene activation of mouse V-set and immunoglobulin domain containing 8
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene VSIG8
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Vsig8 - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 mBFP-Neo donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
Vsig8 - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 Luciferase-Puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
Vsig8 - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 RFP-BSD donor, 1 scramble control |
| Donor DNA | RFP-BSD |
VSIG8 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Vsig8 (untagged) - Mouse V-set and immunoglobulin domain containing 8 (Vsig8), transcript variant 1, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Vsig8 (untagged) - Mouse V-set and immunoglobulin domain containing 8 (cDNA clone MGC:73808 IMAGE:1528324), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Vsig8
VSIG8 MS Standard C13 and N15-labeled recombinant protein (NP_001013683)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Vsig8 (untagged ORF) - Rat similar to hypothetical protein A030011M19 (RGD1562464), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
C1orf204 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
VSIG8 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Vsig8 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Vsig8 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-VSIG8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human VSIG8 |
VSIG8 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human VSIG8 |
Transient overexpression of VSIG8 (NM_001013661) in HEK293T cells paraffin embedded controls for ICC/IHC staining
VSIG8 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- VSIG8