Products

View as table Download

XDH rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Xanthine Oxidase is isolated and purified from Bovine buttermilk.
Freund's complete adjuvant is used in the first step of the immunization procedure.

XDH rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human XDH

Xanthine Oxidase (XDH) Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Xanthine Oxidase (Xanthine Oxidase (XDH)) (NP_000370.2).
Modifications Unmodified

Xanthine Oxidase (XDH) Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Xanthine Oxidase (Xanthine Oxidase (XDH)) (NP_000370.2).
Modifications Unmodified

XDH rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IHC, WB
Reactivities Bovine
Conjugation Biotin
Immunogen Xanthine Oxidase is isolated and purified from Bovine buttermilk.
Freund's complete adjuvant is used in the first step of the immunization procedure.

Xanthine Oxidase (XDH) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 213~242 amino acids from the N-terminal region of human XDH

XDH rabbit polyclonal antibody, Aff - Purified

Applications IP
Reactivities Bovine
Immunogen Xanthine Oxidase is isolated and purified from Bovine buttermilk.
Freund's complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal Anti-XDH Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Xdh antibody is: synthetic peptide directed towards the N-terminal region of Rat Xdh. Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS

XDH rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human XDH