XDH (Myc-DDK-tagged)-Human xanthine dehydrogenase (XDH)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
XDH (Myc-DDK-tagged)-Human xanthine dehydrogenase (XDH)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human xanthine dehydrogenase (XDH)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 1,800.00
3 Weeks
Lenti ORF particles, XDH (Myc-DDK tagged) - Human xanthine dehydrogenase (XDH), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,800.00
6 Weeks
Lenti ORF particles, XDH (mGFP-tagged) - Human xanthine dehydrogenase (XDH), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Xdh (Myc-DDK-tagged) - Mouse xanthine dehydrogenase (Xdh)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
XDH (GFP-tagged) - Human xanthine dehydrogenase (XDH)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Xdh - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Xdh (GFP-tagged) - Mouse xanthine dehydrogenase (Xdh), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Xdh (Myc-DDK-tagged) - Mouse xanthine dehydrogenase (Xdh)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Xdh (Myc-DDK-tagged) - Mouse xanthine dehydrogenase (Xdh), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Xdh (mGFP-tagged) - Mouse xanthine dehydrogenase (Xdh)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Xdh (GFP-tagged) - Mouse xanthine dehydrogenase (Xdh), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human xanthine dehydrogenase (XDH), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,800.00
5 Weeks
Lenti ORF particles, XDH (Myc-DDK tagged) - Human xanthine dehydrogenase (XDH), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human xanthine dehydrogenase (XDH), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,800.00
7 Weeks
Lenti ORF particles, XDH (mGFP-tagged) - Human xanthine dehydrogenase (XDH), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Xdh (Myc-DDK-tagged ORF) - Rat xanthine dehydrogenase (Xdh), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
XDH rabbit polyclonal antibody, Azide Free
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Bovine |
Immunogen | Xanthine Oxidase is isolated and purified from Bovine buttermilk. Freund's complete adjuvant is used in the first step of the immunization procedure. |
Lenti ORF clone of Human xanthine dehydrogenase (XDH), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
XDH rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human XDH |
Xanthine Oxidase (XDH) Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Xanthine Oxidase (Xanthine Oxidase (XDH)) (NP_000370.2). |
Modifications | Unmodified |
Xanthine Oxidase (XDH) Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Xanthine Oxidase (Xanthine Oxidase (XDH)) (NP_000370.2). |
Modifications | Unmodified |
XDH HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
XDH (untagged)-Human xanthine dehydrogenase (XDH)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of xanthine dehydrogenase (XDH)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
XDH rabbit polyclonal antibody, Biotin
Applications | ELISA, ID, IF, IHC, WB |
Reactivities | Bovine |
Conjugation | Biotin |
Immunogen | Xanthine Oxidase is isolated and purified from Bovine buttermilk. Freund's complete adjuvant is used in the first step of the immunization procedure. |
XDH (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Lenti ORF clone of Human xanthine dehydrogenase (XDH), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
XDH - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
Format | Retroviral plasmids |
Vector | pRFP-C-RS |
E. coli Selection | Chloramphenicol |
Mammalian Cell Selection | Puromycin |
Xanthine Oxidase (XDH) guinea pig polyclonal antibody, Serum
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Xanthine Oxidase purified from Bovine Milk Fat Globule Membrane (MFGM). |
Xanthine Oxidase (XDH) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 213~242 amino acids from the N-terminal region of human XDH |
qSTAR qPCR primer pairs against Homo sapiens gene XDH
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
XDH rabbit polyclonal antibody, Aff - Purified
Applications | IP |
Reactivities | Bovine |
Immunogen | Xanthine Oxidase is isolated and purified from Bovine buttermilk. Freund's complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-XDH Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Xdh antibody is: synthetic peptide directed towards the N-terminal region of Rat Xdh. Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS |
Carrier-free (BSA/glycerol-free) XDH mouse monoclonal antibody,clone OTI5D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) XDH mouse monoclonal antibody,clone OTI1C10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
XDH CRISPRa kit - CRISPR gene activation of human xanthine dehydrogenase
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Xdh CRISPRa kit - CRISPR gene activation of mouse xanthine dehydrogenase
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Xdh (untagged) - Mouse xanthine dehydrogenase (Xdh), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Xdh
XDH MS Standard C13 and N15-labeled recombinant protein (NP_000370)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Xdh (untagged ORF) - Rat xanthine dehydrogenase (Xdh), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of xanthine dehydrogenase (XDH) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
Xdh (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Xdh (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
XDH rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human XDH |
XDH mouse monoclonal antibody,clone OTI5D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI5D8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI5D8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
XDH mouse monoclonal antibody,clone OTI5D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |