Products

View as table Download

Recombinant protein of human xanthine dehydrogenase (XDH)

Tag C-Myc/DDK
Expression Host HEK293T

Xdh (Myc-DDK-tagged) - Mouse xanthine dehydrogenase (Xdh)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

XDH (GFP-tagged) - Human xanthine dehydrogenase (XDH)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Xdh - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN519486 is the updated version of KN319486.

Xdh (GFP-tagged) - Mouse xanthine dehydrogenase (Xdh), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Xdh (Myc-DDK-tagged) - Mouse xanthine dehydrogenase (Xdh)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Xdh (mGFP-tagged) - Mouse xanthine dehydrogenase (Xdh)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Xdh (GFP-tagged) - Mouse xanthine dehydrogenase (Xdh), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Xdh (Myc-DDK-tagged ORF) - Rat xanthine dehydrogenase (Xdh), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

XDH rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Xanthine Oxidase is isolated and purified from Bovine buttermilk.
Freund's complete adjuvant is used in the first step of the immunization procedure.

XDH rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human XDH

Xanthine Oxidase (XDH) Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Xanthine Oxidase (Xanthine Oxidase (XDH)) (NP_000370.2).
Modifications Unmodified

Xanthine Oxidase (XDH) Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Xanthine Oxidase (Xanthine Oxidase (XDH)) (NP_000370.2).
Modifications Unmodified

XDH HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

XDH (untagged)-Human xanthine dehydrogenase (XDH)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

XDH rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IHC, WB
Reactivities Bovine
Conjugation Biotin
Immunogen Xanthine Oxidase is isolated and purified from Bovine buttermilk.
Freund's complete adjuvant is used in the first step of the immunization procedure.

XDH (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Lenti ORF clone of Human xanthine dehydrogenase (XDH), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

XDH - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector

Format Retroviral plasmids
Vector pRFP-C-RS
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin

Xanthine Oxidase (XDH) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Xanthine Oxidase purified from Bovine Milk Fat Globule Membrane (MFGM).

Xanthine Oxidase (XDH) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 213~242 amino acids from the N-terminal region of human XDH

qSTAR qPCR primer pairs against Homo sapiens gene XDH

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

XDH rabbit polyclonal antibody, Aff - Purified

Applications IP
Reactivities Bovine
Immunogen Xanthine Oxidase is isolated and purified from Bovine buttermilk.
Freund's complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal Anti-XDH Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Xdh antibody is: synthetic peptide directed towards the N-terminal region of Rat Xdh. Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS

Carrier-free (BSA/glycerol-free) XDH mouse monoclonal antibody,clone OTI5D8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) XDH mouse monoclonal antibody,clone OTI1C10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

XDH CRISPRa kit - CRISPR gene activation of human xanthine dehydrogenase

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Xdh CRISPRa kit - CRISPR gene activation of mouse xanthine dehydrogenase

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Xdh (untagged) - Mouse xanthine dehydrogenase (Xdh), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

qSTAR qPCR primer pairs against Mus musculus gene Xdh

XDH MS Standard C13 and N15-labeled recombinant protein (NP_000370)

Tag C-Myc/DDK
Expression Host HEK293

Xdh (untagged ORF) - Rat xanthine dehydrogenase (Xdh), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

3`UTR clone of xanthine dehydrogenase (XDH) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

Xdh (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Xdh (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

XDH rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human XDH

XDH mouse monoclonal antibody,clone OTI5D8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

XDH mouse monoclonal antibody,clone OTI5D8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated