Germany
Japan
United Kingdom
China
XDH (Myc-DDK-tagged)-Human xanthine dehydrogenase (XDH)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human xanthine dehydrogenase (XDH)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 1,800.00
3 Weeks
Lenti ORF particles, XDH (Myc-DDK tagged) - Human xanthine dehydrogenase (XDH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 1,800.00
6 Weeks
Lenti ORF particles, XDH (mGFP-tagged) - Human xanthine dehydrogenase (XDH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Xdh (Myc-DDK-tagged) - Mouse xanthine dehydrogenase (Xdh)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
XDH (GFP-tagged) - Human xanthine dehydrogenase (XDH)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Xdh - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN519486 is the updated version of KN319486.
Xdh (GFP-tagged) - Mouse xanthine dehydrogenase (Xdh), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Xdh (Myc-DDK-tagged) - Mouse xanthine dehydrogenase (Xdh)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Xdh (Myc-DDK-tagged) - Mouse xanthine dehydrogenase (Xdh), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Xdh (mGFP-tagged) - Mouse xanthine dehydrogenase (Xdh)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Xdh (GFP-tagged) - Mouse xanthine dehydrogenase (Xdh), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human xanthine dehydrogenase (XDH), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,800.00
5 Weeks
Lenti ORF particles, XDH (Myc-DDK tagged) - Human xanthine dehydrogenase (XDH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human xanthine dehydrogenase (XDH), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,800.00
7 Weeks
Lenti ORF particles, XDH (mGFP-tagged) - Human xanthine dehydrogenase (XDH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Xdh (Myc-DDK-tagged ORF) - Rat xanthine dehydrogenase (Xdh), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
XDH rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Immunogen | Xanthine Oxidase is isolated and purified from Bovine buttermilk. Freund's complete adjuvant is used in the first step of the immunization procedure. |
Lenti ORF clone of Human xanthine dehydrogenase (XDH), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Xanthine Oxidase (XDH) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Xanthine Oxidase (Xanthine Oxidase (XDH)) (NP_000370.2). |
| Modifications | Unmodified |
Xanthine Oxidase (XDH) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Xanthine Oxidase (Xanthine Oxidase (XDH)) (NP_000370.2). |
| Modifications | Unmodified |
XDH HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
XDH (untagged)-Human xanthine dehydrogenase (XDH)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of xanthine dehydrogenase (XDH)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
XDH rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IHC, WB |
| Reactivities | Bovine |
| Conjugation | Biotin |
| Immunogen | Xanthine Oxidase is isolated and purified from Bovine buttermilk. Freund's complete adjuvant is used in the first step of the immunization procedure. |
XDH (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Lenti ORF clone of Human xanthine dehydrogenase (XDH), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
XDH - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Xanthine Oxidase (XDH) guinea pig polyclonal antibody, Serum
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Xanthine Oxidase purified from Bovine Milk Fat Globule Membrane (MFGM). |
qSTAR qPCR primer pairs against Homo sapiens gene XDH
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
XDH rabbit polyclonal antibody, Aff - Purified
| Applications | IP |
| Reactivities | Bovine |
| Immunogen | Xanthine Oxidase is isolated and purified from Bovine buttermilk. Freund's complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-XDH Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Xdh antibody is: synthetic peptide directed towards the N-terminal region of Rat Xdh. Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS |
Carrier-free (BSA/glycerol-free) XDH mouse monoclonal antibody,clone OTI5D8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) XDH mouse monoclonal antibody,clone OTI1C10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
XDH CRISPRa kit - CRISPR gene activation of human xanthine dehydrogenase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Xdh CRISPRa kit - CRISPR gene activation of mouse xanthine dehydrogenase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Xdh (untagged) - Mouse xanthine dehydrogenase (Xdh), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Xdh
XDH MS Standard C13 and N15-labeled recombinant protein (NP_000370)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Xdh (untagged ORF) - Rat xanthine dehydrogenase (Xdh), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of xanthine dehydrogenase (XDH) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Xdh (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Xdh (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
XDH mouse monoclonal antibody,clone OTI5D8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI5D8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI5D8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
XDH mouse monoclonal antibody,clone OTI5D8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- XDH