Products

Jump to Filters
View as table Download
ZFP200 (ZNF200) Rabbit Polyclonal Antibody
TA343406

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF200 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF200 antibody: synthetic peptide directed towards the middle region of human ZNF200. Synthetic peptide located within the following region: SRHEGIHIREKIFKCPECGKTFPKNEEFVLHLQSHEAERPYGCKKCGRRF
ZFP200 (ZNF200) Rabbit Polyclonal Antibody
TA351970

USD 345.00

In Stock

Rabbit Polyclonal Anti-EEF1B2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ZNF200