Products

cDNA Clones (48)
Antibodies (42)
Proteins (36)
Gene Expression (4)
RNAi (3)
Jump to Filters
View as table Download
ZFP200 (ZNF200) (NM_003454) Human Tagged ORF Clone
RC207594

USD 420.00

In Stock

ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ZFP200 (ZNF200) (NM_198087) Human Tagged ORF Clone
RC208779

USD 420.00

In Stock

ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ZFP200 (ZNF200) (NM_198088) Human Tagged ORF Clone
RC215499

USD 420.00

In Stock

ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ZFP200 (ZNF200) (NM_001145446) Human Tagged ORF Clone
RC227651

USD 420.00

In Stock

ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ZFP200 (ZNF200) (NM_001145447) Human Tagged ORF Clone
RC227694

USD 420.00

In Stock

ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ZFP200 (ZNF200) (NM_001145448) Human Tagged ORF Clone
RC227730

USD 420.00

In Stock

ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ZFP200 (ZNF200) (NM_003454) Human Tagged ORF Clone
RG207594

USD 460.00

In Stock

ZNF200 (GFP-tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ZFP200 (ZNF200) (NM_198087) Human Tagged ORF Clone
RG208779

USD 460.00

In Stock

ZNF200 (GFP-tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ZFP200 (ZNF200) Human Gene Knockout Kit (CRISPR)
KN407594

USD 1,290.00

2 Weeks

ZNF200 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN407594 is the updated version of KN207594.
ZFP200 (ZNF200) (NM_003454) Human Tagged ORF Clone
RC207594L3

USD 620.00

3 Weeks

Lenti ORF clone of Human zinc finger protein 200 (ZNF200), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_003454) Human Tagged ORF Clone Lentiviral Particle
RC207594L3V

USD 820.00

6 Weeks

Lenti ORF particles, ZNF200 (Myc-DDK tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_003454) Human Tagged ORF Clone
RC207594L4

USD 620.00

3 Weeks

Lenti ORF clone of Human zinc finger protein 200 (ZNF200), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_198087) Human Tagged ORF Clone
RC208779L3

USD 620.00

3 Weeks

Lenti ORF clone of Human zinc finger protein 200 (ZNF200), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_198087) Human Tagged ORF Clone Lentiviral Particle
RC208779L3V

USD 820.00

6 Weeks

Lenti ORF particles, ZNF200 (Myc-DDK tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_198087) Human Tagged ORF Clone
RC208779L4

USD 620.00

3 Weeks

Lenti ORF clone of Human zinc finger protein 200 (ZNF200), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_198088) Human Tagged ORF Clone
RC215499L3

USD 620.00

3 Weeks

Lenti ORF clone of Human zinc finger protein 200 (ZNF200), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_198088) Human Tagged ORF Clone Lentiviral Particle
RC215499L3V

USD 820.00

6 Weeks

Lenti ORF particles, ZNF200 (Myc-DDK tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_198088) Human Tagged ORF Clone
RC215499L4

USD 620.00

3 Weeks

Lenti ORF clone of Human zinc finger protein 200 (ZNF200), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_001145446) Human Tagged ORF Clone
RC227651L3

USD 620.00

3 Weeks

Lenti-ORF clone of ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_001145446) Human Tagged ORF Clone Lentiviral Particle
RC227651L3V

USD 820.00

6 Weeks

Lenti ORF particles, ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_001145446) Human Tagged ORF Clone
RC227651L4

USD 620.00

3 Weeks

Lenti-ORF clone of ZNF200 (mGFP-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_001145447) Human Tagged ORF Clone
RC227694L3

USD 620.00

3 Weeks

Lenti-ORF clone of ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_001145447) Human Tagged ORF Clone Lentiviral Particle
RC227694L3V

USD 820.00

6 Weeks

Lenti ORF particles, ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_001145447) Human Tagged ORF Clone
RC227694L4

USD 620.00

3 Weeks

Lenti-ORF clone of ZNF200 (mGFP-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_001145448) Human Tagged ORF Clone
RC227730L3

USD 620.00

3 Weeks

Lenti-ORF clone of ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 6

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_001145448) Human Tagged ORF Clone Lentiviral Particle
RC227730L3V

USD 820.00

6 Weeks

Lenti ORF particles, ZNF200 (Myc-DDK-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_001145448) Human Tagged ORF Clone
RC227730L4

USD 620.00

3 Weeks

Lenti-ORF clone of ZNF200 (mGFP-tagged)-Human zinc finger protein 200 (ZNF200), transcript variant 6

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ZFP200 (ZNF200) (NM_198088) Human Tagged ORF Clone
RG215499

USD 460.00

3 Weeks

ZNF200 (GFP-tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ZFP200 (ZNF200) (NM_001145446) Human Tagged ORF Clone
RG227651

USD 460.00

3 Weeks

ZNF200 (GFP-tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ZFP200 (ZNF200) (NM_001145447) Human Tagged ORF Clone
RG227694

USD 460.00

3 Weeks

ZNF200 (GFP-tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ZFP200 (ZNF200) (NM_001145448) Human Tagged ORF Clone
RG227730

USD 460.00

3 Weeks

ZNF200 (GFP-tagged) - Human zinc finger protein 200 (ZNF200), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ZFP200 (ZNF200) (NM_198087) Human Recombinant Protein
TP760180

USD 215.00

In Stock

Recombinant protein of human zinc finger protein 200 (ZNF200), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
ZFP200 (ZNF200) (NM_003454) Human Untagged Clone
SC117943

USD 310.00

In Stock

ZNF200 (untagged)-Human zinc finger protein 200 (ZNF200), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ZFP200 (ZNF200) (NM_198088) Human Recombinant Protein
TP760732

USD 215.00

In Stock

Purified recombinant protein of Human zinc finger protein 200 (ZNF200), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
ZFP200 (ZNF200) Rabbit Polyclonal Antibody
TA343406

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF200 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF200 antibody: synthetic peptide directed towards the middle region of human ZNF200. Synthetic peptide located within the following region: SRHEGIHIREKIFKCPECGKTFPKNEEFVLHLQSHEAERPYGCKKCGRRF
ZFP200 (ZNF200) Mouse Monoclonal Antibody [Clone ID: OTI5F4]
CF808207

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZNF200 mouse monoclonal antibody, clone OTI5F4 (formerly 5F4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
ZFP200 (ZNF200) Mouse Monoclonal Antibody [Clone ID: OTI7C6]
CF808209

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ZNF200 mouse monoclonal antibody, clone OTI7C6 (formerly 7C6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
ZFP200 (ZNF200) Mouse Monoclonal Antibody [Clone ID: OTI3B6]
CF808210

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZNF200 mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)

Applications WB
Reactivities Human
Conjugation Unconjugated
ZFP200 (ZNF200) Mouse Monoclonal Antibody [Clone ID: OTI1F3]
CF808211

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZNF200 mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)

Applications WB
Reactivities Human
Conjugation Unconjugated
ZFP200 (ZNF200) Mouse Monoclonal Antibody [Clone ID: OTI6F10]
CF808214

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZNF200 mouse monoclonal antibody, clone OTI6F10 (formerly 6F10)

Applications WB
Reactivities Human
Conjugation Unconjugated
ZFP200 (ZNF200) Mouse Monoclonal Antibody [Clone ID: OTI3D1]
CF808250

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZNF200 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications WB
Reactivities Human
Conjugation Unconjugated
ZFP200 (ZNF200) Mouse Monoclonal Antibody [Clone ID: OTI1A5]
CF808254

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZNF200 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications WB
Reactivities Human
Conjugation Unconjugated
ZFP200 (ZNF200) Mouse Monoclonal Antibody [Clone ID: OTI4C4]
CF808262

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZNF200 mouse monoclonal antibody, clone OTI4C4 (formerly 4C4)

Applications WB
Reactivities Human
Conjugation Unconjugated