Rabbit Monoclonal Antibody against CCND1 (Clone EPR2241IHC)
Applications | Assay, IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit Monoclonal Antibody against CCND1 (Clone EPR2241IHC)
Applications | Assay, IHC, WB |
Reactivities | Human, Mouse, Rat |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone TB21, Aff - Purified
Applications | Assay, ELISA, FC, IHC, NEUT, WB |
Reactivities | Human |
USD 340.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
Applications | Assay, ELISA, FC, IHC |
Reactivities | Human |
USD 125.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
Applications | Assay, ELISA, FC, IHC |
Reactivities | Human |
Rabbit Polyclonal anti-TP53 antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Mouse Monoclonal anti-TP53 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal anti-TP53 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal anti-TP53 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |