Mouse Monoclonal H3K4me3 Antibody
Applications | Assay, ELISA, IF, WB |
Reactivities | Human |
Mouse Monoclonal H3K4me3 Antibody
Applications | Assay, ELISA, IF, WB |
Reactivities | Human |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
Applications | Assay, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Rabbit Polyclonal H3K9me3 Antibody
Applications | Assay, Dot, ELISA, IF, WB |
Reactivities | Human, Mouse |
Immunogen | The immunogen for anti-H3K9me3 antibody: histone H3 containing the trimethylated lysine 9 (H3K9me3), using a KLH-conjugated synthetic peptide. |
Mouse Monoclonal H3K4me1 Antibody
Applications | Assay, ELISA, IF, WB |
Reactivities | Human |
Mouse Monoclonal H3K4me2 Antibody
Applications | Assay, ELISA, IF, WB |
Reactivities | Human |
Mouse Monoclonal H3K9me2 Antibody
Applications | Assay, ELISA, IF, WB |
Reactivities | Human |
Rabbit Polyclonal H3K4me3 Antibody
Applications | Assay, Dot, ELISA, WB |
Reactivities | Human |
Immunogen | The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide. |
Mouse Monoclonal H3K9un Antibody
Applications | Assay, IF, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-HIST2H2BF Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HIST2H2BF Antibody: synthetic peptide directed towards the N terminal of human HIST2H2BF. Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH |