Rabbit anti-EZH2 Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human EZH2 |
Rabbit anti-EZH2 Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human EZH2 |
Mouse monoclonal EZH2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-EZH2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EZH2 antibody: synthetic peptide directed towards the N terminal of human EZH2. Synthetic peptide located within the following region: KGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQE |
Carrier-free (BSA/glycerol-free) EZH2 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EZH2 mouse monoclonal antibody, clone OTI10B10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EZH2 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EZH2 mouse monoclonal antibody,clone 2B10, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
EZH2 mouse monoclonal antibody,clone 2B10, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
EZH2 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EZH2 mouse monoclonal antibody, clone OTI10B10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
EZH2 mouse monoclonal antibody,clone 10B10, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
EZH2 mouse monoclonal antibody,clone 10B10, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
EZH2 mouse monoclonal antibody, clone OTI10B10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EZH2 mouse monoclonal antibody,clone UMAB264
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EZH2 mouse monoclonal antibody,clone UMAB264
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EZH2 mouse monoclonal antibody,clone UMAB264
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |