Products

View as table Download

Rabbit anti-EZH2 Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EZH2

Rabbit Polyclonal Anti-EZH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EZH2 antibody: synthetic peptide directed towards the N terminal of human EZH2. Synthetic peptide located within the following region: KGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQE

Carrier-free (BSA/glycerol-free) EZH2 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EZH2 mouse monoclonal antibody, clone OTI10B10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EZH2 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EZH2 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EZH2 mouse monoclonal antibody, clone OTI10B10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EZH2 mouse monoclonal antibody, clone OTI10B10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EZH2 mouse monoclonal antibody,clone UMAB264

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EZH2 mouse monoclonal antibody,clone UMAB264

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EZH2 mouse monoclonal antibody,clone UMAB264

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated