Products

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 39 of 39 results

(reset)

SHMT2 Rabbit Polyclonal Antibody

TA327002

USD 380.00

3 Weeks

Rabbit anti-SHMT2 Polyclonal Antibody

Applications	ICC/IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human SHMT2

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GGT1 Rabbit Polyclonal Antibody

TA327174

USD 275.00

3 Weeks

GGT1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human GGT1

GGT1 (381-471) Mouse Monoclonal Antibody [Clone ID: 1F9]

AM31063PU-N

USD 480.00

2 Weeks

GGT1 (381-471) mouse monoclonal antibody, clone 1F9, Purified

Applications	ELISA, IHC, IP, WB
Reactivities	Human, Mouse

1 / 2

2 / 2

Previous Next

SHMT1 (374-483) Mouse Monoclonal Antibody [Clone ID: 4F9]

AM20941PU-N

USD 480.00

2 Weeks

SHMT1 (374-483) mouse monoclonal antibody, clone 4F9, Purified

Applications	ELISA, IHC, WB
Reactivities	Human

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

GBA3 (C-term) Rabbit Polyclonal Antibody

AP51789PU-N

USD 450.00

2 Weeks

GBA3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 295-325 amino acids from the C-terminal region of Human Cytosolic beta-glucosidase

1 / 2

2 / 2

Previous Next

GGT1 Rabbit Polyclonal Antibody

TA308190

USD 415.00

5 Days

Rabbit Polyclonal antibody to GGT1 (gamma-glutamyltransferase 1)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 226 of GGT1 (Uniprot ID#P19440)

1 / 3

2 / 3

3 / 3

Previous Next

SHMT2 Rabbit Polyclonal Antibody

TA339281

USD 310.00

5 Days

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the N terminal of human SHMT2. Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR

1 / 2

2 / 2

Previous Next

SHMT2 Rabbit Polyclonal Antibody

TA339282

USD 375.00

5 Days

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the C terminal of human SHMT2. Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE

1 / 2

2 / 2

Previous Next

GBA3 Mouse Monoclonal Antibody [Clone ID: OTI3E8]

CF502516

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GBA3 mouse monoclonal antibody, clone OTI3E8 (formerly 3E8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GBA3 Mouse Monoclonal Antibody [Clone ID: OTI5G5]

CF502533

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GBA3 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GBA3 Mouse Monoclonal Antibody [Clone ID: OTI1F1]

CF502602

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GBA3 mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 21

2 / 21

3 / 21

4 / 21

5 / 21

6 / 21

7 / 21

8 / 21

9 / 21

10 / 21

11 / 21

12 / 21

13 / 21

14 / 21

15 / 21

16 / 21

17 / 21

18 / 21

19 / 21

20 / 21

21 / 21

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E12]

CF808813

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody,clone OTI1E12

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E6]

CF808814

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody,clone OTI1E6

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI3E9]

CF808820

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

GGT1 Rabbit Polyclonal Antibody

TA350015

USD 345.00

In Stock

Rabbit Polyclonal Anti-GGT1 Antibody

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human GGT1

GBA3 Mouse Monoclonal Antibody [Clone ID: OTI3E8]

TA502516

USD 379.00

In Stock

GBA3 mouse monoclonal antibody, clone OTI3E8 (formerly 3E8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GBA3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E8]

TA502516AM

USD 420.00

4 Weeks

GBA3 mouse monoclonal antibody, clone OTI3E8 (formerly 3E8), Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GBA3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E8]

TA502516BM

USD 420.00

4 Weeks

GBA3 mouse monoclonal antibody, clone OTI3E8 (formerly 3E8), HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GBA3 Mouse Monoclonal Antibody [Clone ID: OTI3E8]

TA502516S

USD 159.00

2 Days

GBA3 mouse monoclonal antibody, clone OTI3E8 (formerly 3E8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GBA3 Mouse Monoclonal Antibody [Clone ID: OTI5G5]

TA502533

USD 379.00

In Stock

GBA3 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GBA3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G5]

TA502533AM

USD 420.00

4 Weeks

GBA3 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GBA3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G5]

TA502533BM

USD 420.00

4 Weeks

GBA3 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GBA3 Mouse Monoclonal Antibody [Clone ID: OTI5G5]

TA502533S

USD 159.00

2 Days

GBA3 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GBA3 Mouse Monoclonal Antibody [Clone ID: OTI1F1]

TA502602

USD 379.00

In Stock

GBA3 mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 21

2 / 21

3 / 21

4 / 21

5 / 21

6 / 21

7 / 21

8 / 21

9 / 21

10 / 21

11 / 21

12 / 21

13 / 21

14 / 21

15 / 21

16 / 21

17 / 21

18 / 21

19 / 21

20 / 21

21 / 21

Previous Next

GBA3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F1]

TA502602AM

USD 420.00

4 Weeks

GBA3 mouse monoclonal antibody, clone OTI1F1 (formerly 1F1), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 21

2 / 21

3 / 21

4 / 21

5 / 21

6 / 21

7 / 21

8 / 21

9 / 21

10 / 21

11 / 21

12 / 21

13 / 21

14 / 21

15 / 21

16 / 21

17 / 21

18 / 21

19 / 21

20 / 21

21 / 21

Previous Next

GBA3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F1]

TA502602BM

USD 420.00

4 Weeks

GBA3 mouse monoclonal antibody, clone OTI1F1 (formerly 1F1), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 21

2 / 21

3 / 21

4 / 21

5 / 21

6 / 21

7 / 21

8 / 21

9 / 21

10 / 21

11 / 21

12 / 21

13 / 21

14 / 21

15 / 21

16 / 21

17 / 21

18 / 21

19 / 21

20 / 21

21 / 21

Previous Next

GBA3 Mouse Monoclonal Antibody [Clone ID: OTI1F1]

TA502602S

USD 159.00

2 Days

GBA3 mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 21

2 / 21

3 / 21

4 / 21

5 / 21

6 / 21

7 / 21

8 / 21

9 / 21

10 / 21

11 / 21

12 / 21

13 / 21

14 / 21

15 / 21

16 / 21

17 / 21

18 / 21

19 / 21

20 / 21

21 / 21

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E12]

TA808813

USD 379.00

In Stock

SHMT2 mouse monoclonal antibody,clone OTI1E12

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SHMT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E12]

TA808813AM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody,clone OTI1E12, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SHMT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E12]

TA808813BM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody,clone OTI1E12, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E12]

TA808813S

USD 159.00

2 Days

SHMT2 mouse monoclonal antibody,clone OTI1E12

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E6]

TA808814

USD 379.00

In Stock

SHMT2 mouse monoclonal antibody,clone OTI1E6

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SHMT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E6]

TA808814AM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody,clone OTI1E6, Biotinylated

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SHMT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E6]

TA808814BM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody,clone OTI1E6, HRP conjugated

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E6]

TA808814S

USD 159.00

2 Days

SHMT2 mouse monoclonal antibody,clone OTI1E6

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI3E9]

TA808820

USD 379.00

In Stock

SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SHMT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E9]

TA808820AM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SHMT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E9]

TA808820BM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI3E9]

TA808820S

USD 159.00

2 Days

SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

1 - 39 of 39 results