Products

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 70 results

Page 1 of 2

(reset)

CBS Rabbit Polyclonal Antibody

TA308071

USD 415.00

In Stock

Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)

Applications	IF, IHC, IP, WB
Reactivities	Human
Immunogen	Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CBS Rabbit Polyclonal Antibody

TA338394

USD 310.00

5 Days

Rabbit Polyclonal Anti-CBS Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

MAT1A Rabbit Polyclonal Antibody

TA346036

USD 410.00

5 Days

Rabbit Polyclonal Anti-MAT1A Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the N terminal of human MAT1A. Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE

1 / 2

2 / 2

Previous Next

BUD23 Rabbit Polyclonal Antibody

TA308485

USD 415.00

In Stock

Rabbit Polyclonal antibody to WBSCR22 (Williams Beuren syndrome chromosome region 22)

Applications	IHC, IP, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 263 of WBSCR22 (Uniprot ID#O43709)

1 / 3

2 / 3

3 / 3

Previous Next

GGT1 Rabbit Polyclonal Antibody

TA327174

USD 275.00

3 Weeks

GGT1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human GGT1

GGT1 (381-471) Mouse Monoclonal Antibody [Clone ID: 1F9]

AM31063PU-N

USD 480.00

2 Weeks

GGT1 (381-471) mouse monoclonal antibody, clone 1F9, Purified

Applications	ELISA, IHC, IP, WB
Reactivities	Human, Mouse

1 / 2

2 / 2

Previous Next

CBSL Mouse Monoclonal Antibody [Clone ID: 3E1]

AM31730PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 3E1, Purified

Applications	ELISA, IHC, IP, WB
Reactivities	Human, Rat

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

LCMT1 Rabbit Polyclonal Antibody

TA350130

USD 345.00

In Stock

Rabbit Polyclonal Anti-LCMT1 Antibody

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human LCMT1

1 / 3

2 / 3

3 / 3

Previous Next

MAT2A Mouse Monoclonal Antibody [Clone ID: AT3A2]

AM09067PU-N

USD 340.00

2 Weeks

MAT2A mouse monoclonal antibody, clone AT3A2, Purified

Applications	ELISA, IHC, WB
Reactivities	Human

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

MAT2A Mouse Monoclonal Antibody [Clone ID: AT3A2]

AM09067PU-S

USD 230.00

2 Weeks

MAT2A mouse monoclonal antibody, clone AT3A2, Purified

Applications	ELISA, IHC, WB
Reactivities	Human

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CBSL Mouse Monoclonal Antibody [Clone ID: 6B8]

AM31731PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 6B8, Purified

Applications	ELISA, IHC, WB
Reactivities	Human

1 / 3

2 / 3

3 / 3

Previous Next

CBSL Mouse Monoclonal Antibody [Clone ID: 6A9]

AM31732PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 6A9, Purified

Applications	ELISA, IHC, WB
Reactivities	Human

1 / 3

2 / 3

3 / 3

Previous Next

CBSL Mouse Monoclonal Antibody [Clone ID: 5F7]

AM31733PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 5F7, Purified

Applications	ELISA, IHC, WB
Reactivities	Human

1 / 3

2 / 3

3 / 3

Previous Next

S adenosylhomocysteine hydrolase (AHCY) (N-term) Rabbit Polyclonal Antibody

AP50117PU-N

USD 450.00

2 Weeks

S adenosylhomocysteine hydrolase (AHCY) (N-term) rabbit polyclonal antibody, Purified

Applications	FC, IHC, WB
Reactivities	Human, Mouse
Immunogen	KLH conjugated synthetic peptide between 86-118 amino acids from the N-terminal region of human AHCY

1 / 3

2 / 3

3 / 3

Previous Next

HEMK1 (C-term) Rabbit Polyclonal Antibody

AP52029PU-N

USD 450.00

2 Weeks

HEMK1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 311-338 amino acids from the C-terminal region of human HEMK1

1 / 2

2 / 2

Previous Next

Selenophosphate synthetase 1 (SEPHS1) Rabbit Polyclonal Antibody

TA308432

USD 415.00

5 Days

Rabbit polyclonal antibody to Selenophosphate synthetase 1 (selenophosphate synthetase 1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 204 of Selenophosphate synthetase 1 (Uniprot ID#P49903)

1 / 3

2 / 3

3 / 3

Previous Next

AHCYL2 Rabbit Polyclonal Antibody

TA308718

USD 415.00

5 Days

Rabbit Polyclonal antibody to AHCYL2 (adenosylhomocysteinase-like 2)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 298 and 578 of AHCYL2 (Uniprot ID#Q96HN2)

1 / 3

2 / 3

3 / 3

Previous Next

LCMT2 Rabbit Polyclonal Antibody

TA319792

USD 430.00

5 Days

Rabbit Polyclonal TYW4 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4.

1 / 3

2 / 3

3 / 3

Previous Next

Cystathionase (CTH) Rabbit Polyclonal Antibody

TA339248

USD 310.00

5 Days

Rabbit Polyclonal Anti-CTH Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-CTH antibody: synthetic peptide directed towards the C terminal of human CTH. Synthetic peptide located within the following region: ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK

1 / 2

2 / 2

Previous Next

MAT1A (N-term) Rabbit Polyclonal Antibody

AP52613PU-N

USD 450.00

2 Weeks

MAT1A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 114-144 amino acids from the N-terminal region of human MAT1A

1 / 2

2 / 2

Previous Next

MAT2B (N-term) Rabbit Polyclonal Antibody

AP52614PU-N

USD 450.00

2 Weeks

MAT2B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 86~116 amino acids from the N-terminal region of human MAT2B

1 / 2

2 / 2

Previous Next

GGT1 Rabbit Polyclonal Antibody

TA308190

USD 415.00

5 Days

Rabbit Polyclonal antibody to GGT1 (gamma-glutamyltransferase 1)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 226 of GGT1 (Uniprot ID#P19440)

1 / 3

2 / 3

3 / 3

Previous Next

Cystathionase (CTH) Mouse Monoclonal Antibody [Clone ID: OTI1E12]

CF502442

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CTH mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Cystathionase (CTH) Mouse Monoclonal Antibody [Clone ID: OTI2D6]

CF502443

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CTH mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

LCMT1 Mouse Monoclonal Antibody [Clone ID: OTI2C9]

CF503125

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) LCMT1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

LCMT1 Mouse Monoclonal Antibody [Clone ID: OTI1G5]

CF503127

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) LCMT1 mouse monoclonal antibody, clone OTI 1G5 (formerly 1G5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

LCMT1 Mouse Monoclonal Antibody [Clone ID: OTI4A5]

CF503138

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) LCMT1 mouse monoclonal antibody, clone OTI4A5 (formerly 4A5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI3H10]

CF807109

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI7E8]

CF807112

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI6H10]

CF807127

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody,clone OTI6H10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI2E7]

CF807130

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PAPSS1 Rabbit Polyclonal Antibody

TA349567

USD 345.00

In Stock

Rabbit Polyclonal Anti-PAPSS1 Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human PAPSS1

CBS Rabbit Polyclonal Antibody

TA349577

USD 345.00

In Stock

Rabbit Polyclonal Anti-CBS Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human CBS

1 / 3

2 / 3

3 / 3

Previous Next

GGT1 Rabbit Polyclonal Antibody

TA350015

USD 345.00

In Stock

Rabbit Polyclonal Anti-GGT1 Antibody

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human GGT1

Cystathionase (CTH) Mouse Monoclonal Antibody [Clone ID: OTI1E12]

TA502442

USD 379.00

In Stock

CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Cystathionase (CTH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E12]

TA502442AM

USD 420.00

4 Weeks

CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12), Biotinylated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Biotin

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Cystathionase (CTH) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E12]

TA502442BM

USD 420.00

4 Weeks

CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	HRP

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Cystathionase (CTH) Mouse Monoclonal Antibody [Clone ID: OTI1E12]

TA502442S

USD 159.00

2 Days

CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Cystathionase (CTH) Mouse Monoclonal Antibody [Clone ID: OTI2D6]

TA502443

USD 379.00

In Stock

CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Cystathionase (CTH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D6]

TA502443AM

USD 420.00

4 Weeks

CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6), Biotinylated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Biotin

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Cystathionase (CTH) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D6]

TA502443BM

USD 420.00

4 Weeks

CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	HRP

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Cystathionase (CTH) Mouse Monoclonal Antibody [Clone ID: OTI2D6]

TA502443S

USD 159.00

2 Days

CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

LCMT1 Mouse Monoclonal Antibody [Clone ID: OTI2C9]

TA503125

USD 379.00

In Stock

LCMT1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

LCMT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C9]

TA503125AM

USD 420.00

4 Weeks

LCMT1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), Biotinylated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

LCMT1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C9]

TA503125BM

USD 420.00

4 Weeks

LCMT1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

LCMT1 Mouse Monoclonal Antibody [Clone ID: OTI2C9]

TA503125S

USD 159.00

In Stock

LCMT1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

LCMT1 Mouse Monoclonal Antibody [Clone ID: OTI1G5]

TA503127

USD 379.00

In Stock

LCMT1 mouse monoclonal antibody, clone OTI 1G5 (formerly 1G5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

LCMT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G5]

TA503127AM

USD 420.00

4 Weeks

LCMT1 mouse monoclonal antibody, clone OTI 1G5 (formerly 1G5), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

LCMT1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G5]

TA503127BM

USD 420.00

4 Weeks

LCMT1 mouse monoclonal antibody, clone OTI 1G5 (formerly 1G5), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

LCMT1 Mouse Monoclonal Antibody [Clone ID: OTI1G5]

TA503127S

USD 159.00

2 Days

LCMT1 mouse monoclonal antibody, clone OTI 1G5 (formerly 1G5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

1 - 50 of 70 results

Page 1 of 2