Products

Jump to Filters
View as table Download
E74 like factor 1 (ELF1) Rabbit Polyclonal Antibody
TA329207

USD 375.00

5 Days

Rabbit Polyclonal anti-ELF1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELF1 antibody: synthetic peptide directed towards the N terminal of human ELF1. Synthetic peptide located within the following region: VTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATT
ELF1 Rabbit Polyclonal Antibody
TA364771

USD 380.00

4 Weeks

ELF1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ELF1
ELF1 Rabbit Polyclonal Antibody
TA369102

USD 380.00

4 Weeks

ELF1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ELF1