Products

View as table Download

GJB1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GJB1

GJB1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 81-130 of Human Connexin 32.

GJB1 mouse monoclonal antibody, clone CXN-32, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Rabbit Polyclonal Anti-GJB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the middle region of human GJB1. Synthetic peptide located within the following region: RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILR

Rabbit Polyclonal Anti-GJB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the C terminal of human GJB1. Synthetic peptide located within the following region: GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC

GJB1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GJB1