PRP19 (PRPF19) (C-term) guinea pig polyclonal antibody, Serum
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic C-terminal peptide of human Prp19p protein (aa 182-192) conjugated to KLH |
PRP19 (PRPF19) (C-term) guinea pig polyclonal antibody, Serum
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic C-terminal peptide of human Prp19p protein (aa 182-192) conjugated to KLH |
Rabbit Polyclonal Anti-PRPF19 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the middle region of human PRPF19. Synthetic peptide located within the following region: PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK |
PRPF19 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PRPF19 |
PRPF19 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PRPF19 |
PRP19 Rabbit polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 127-416 of human PRP19 (NP_055317.1). |
Modifications | Unmodified |
PRP19 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human PRP19 (NP_055317.1). |
Modifications | Unmodified |