Germany
Japan
United Kingdom
China
PRPF19 (Myc-DDK-tagged)-Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Prpf19 (Myc-DDK-tagged) - Mouse PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (Prpf19)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, PRPF19 (Myc-DDK tagged) - Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, PRPF19 (mGFP-tagged) - Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PRPF19 (GFP-tagged) - Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PRPF19 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN400810 is the updated version of KN200810.
Prpf19 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513966 is the updated version of KN313966.
Prpf19 (GFP-tagged) - Mouse PRP19/PSO4 pre-mRNA processing factor 19 homolog (S
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Prpf19 (Myc-DDK-tagged) - Mouse PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (Prpf19)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Prpf19 (Myc-DDK-tagged) - Mouse PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (Prpf19), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Prpf19 (mGFP-tagged) - Mouse PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (Prpf19)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Prpf19 (GFP-tagged) - Mouse PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (Prpf19), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Prpf19 (myc-DDK-tagged) - Mouse PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (Prpf19), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Prpf19 (myc-DDK-tagged) - Mouse PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (Prpf19), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
5 Weeks
Lenti ORF particles, PRPF19 (Myc-DDK tagged) - Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, PRPF19 (mGFP-tagged) - Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Prpf19 (Myc-DDK-tagged ORF) - Rat PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (Prpf19), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Prpf19 (Myc-DDK-tagged ORF) - Rat PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (Prpf19), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Prpf19 (Myc-DDK-tagged ORF) - Rat PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (Prpf19), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Prpf19 (mGFP-tagged ORF) - Rat PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (Prpf19), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Prpf19 (GFP-tagged ORF) - Rat PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (Prpf19), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PRPF19 (untagged)-Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
PRP19 (PRPF19) (C-term) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic C-terminal peptide of human Prp19p protein (aa 182-192) conjugated to KLH |
Lenti ORF clone of Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-PRPF19 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the middle region of human PRPF19. Synthetic peptide located within the following region: PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK |
PRPF19 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Prpf19 (untagged) - Mouse PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (Prpf19), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Homo sapiens gene PRPF19
Rabbit Polyclonal Anti-PRPF19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the N terminal of human PRPF19. Synthetic peptide located within the following region: VPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP |
PRPF19 CRISPRa kit - CRISPR gene activation of human pre-mRNA processing factor 19
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Prpf19 CRISPRa kit - CRISPR gene activation of mouse pre-mRNA processing factor 19
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PRPF19
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene PRPF19
| Application | Plasmid of exact quantity for transcript copy number calculation |
Transient overexpression lysate of PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Prpf19 (untagged) - Mouse PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (Prpf19), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Prpf19 (untagged) - Mouse PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (Prpf19), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qPCR primer pairs and template standards against Mus musculus gene Prpf19
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Prpf19
PRPF19 MS Standard C13 and N15-labeled recombinant protein (NP_055317)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Prpf19 (untagged ORF) - Rat PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (Prpf19), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Prpf19 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Prpf19 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
PRPF19 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PRPF19 |
PRP19 Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 127-416 of human PRP19 (NP_055317.1). |
| Modifications | Unmodified |
PRP19 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human PRP19 (NP_055317.1). |
| Modifications | Unmodified |
Transient overexpression of PRPF19 (NM_014502) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- PRPF19