Anti-SAA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-122 amino acids of human serum amyloid A1 |
Anti-SAA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-122 amino acids of human serum amyloid A1 |
Rabbit Polyclonal Anti-Saa1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Saa1 antibody is: synthetic peptide directed towards the middle region of Mouse Saa1. Synthetic peptide located within the following region: DKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEA |
Serum Amyloid A (SAA1) mouse monoclonal antibody, clone n.n, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Serum Amyloid A (SAA1) mouse monoclonal antibody, clone B333A, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Serum Amyloid A (SAA1) mouse monoclonal antibody, clone 504, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Serum Amyloid A (SAA1) mouse monoclonal antibody, clone 585, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Serum Amyloid A (SAA1) mouse monoclonal antibody, clone 426, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Serum Amyloid A (SAA1) mouse monoclonal antibody, clone 38, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Serum Amyloid A (SAA1) mouse monoclonal antibody, clone S3-F11, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Serum Amyloid A (SAA1) mouse monoclonal antibody, clone B336A, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Serum Amyloid A (SAA1) mouse monoclonal antibody, clone B332A, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Serum Amyloid A (SAA1) mouse monoclonal antibody, clone 513, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Serum Amyloid A (SAA1) mouse monoclonal antibody, clone 291, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SAA1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SAA1 (NP_000322.2). |
Modifications | Unmodified |
SAA1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-122 of human SAA1 (NP_000322.2). |
Modifications | Unmodified |