Products

View as table Download

LOC102723996 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 216-246 amino acids from the C-terminal region of human CD275 / ICOS Ligand

Rabbit Polyclonal Anti-ICOSLG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ICOSLG antibody is: synthetic peptide directed towards the N-terminal region of Human ICOSLG. Synthetic peptide located within the following region: VDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEV

Rabbit Polyclonal Anti-ICOSLG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ICOSLG

ICOSL Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-256 of human ICOSL (NP_056074.1).
Modifications Unmodified