Products

View as table Download

Rabbit polyclonal anti-HSP105 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HSP105.

Rabbit Polyclonal Anti-HSP105 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HSP105 Antibody: A synthesized peptide derived from human HSP105

Rabbit polyclonal Hsp110 Antibody

Applications WB
Reactivities Hamster, Human, Monkey, Mouse, Rat, Sheep, Yeast, Cow
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the sequence of hamster Hsp110; sequence identical to human and mouse

Rabbit Polyclonal Anti-HSPH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPH1 antibody: synthetic peptide directed towards the middle region of human HSPH1. Synthetic peptide located within the following region: EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQ

Anti-HSPH1 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human heat shock 105kDa/110kDa protein 1

Anti-HSPH1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human heat shock 105kDa/110kDa protein 1

Hsph1 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated

HSPH1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HSPH1

HSPH1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HSPH1

HSPH1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HSPH1

HSPH1 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse HSPH1

HSP105/HSPH1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 659-858 of human HSP105/HSP105/HSPH1 (NP_006635.2).
Modifications Unmodified