Rabbit Polyclonal antibody to Apelin Receptor (apelin receptor)
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide corresponding to a region within amino acids 2 and 96 of Apelin Receptor (Uniprot ID#P35414) |
Rabbit Polyclonal antibody to Apelin Receptor (apelin receptor)
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide corresponding to a region within amino acids 2 and 96 of Apelin Receptor (Uniprot ID#P35414) |
Rabbit Polyclonal antibody to Apelin Receptor (apelin receptor)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 284 and 376 of Apelin Receptor (Uniprot ID#P35414) |
Rabbit polyclonal anti-AGTRL1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AGTRL1. |
Rabbit Polyclonal Anti-APLNR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APLNR antibody: synthetic peptide directed towards the N terminal of human APLNR. Synthetic peptide located within the following region: NGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDW |
Anti-APLNR Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 272-380 amino acids of human apelin receptor |