Products

View as table Download

Rabbit polyclonal antibody to ABCD2 (ATP-binding cassette, sub-family D (ALD), member 2)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 338 and 588 of ABCD2 (Uniprot ID#Q9UBJ2)

ABCD2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 552-582 amino acids from the C-terminal region of human ABCD2.

ABCD2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 276~306 amino acids from the Central region of human ABCD2.

Goat Anti-ABCD2 (aa460-473) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PLSDTLAIKGKVID, from the internal region of the protein sequence according to NP_005155.1.

Rabbit Polyclonal Anti-ABCD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCD2 Antibody: synthetic peptide directed towards the N terminal of human ABCD2. Synthetic peptide located within the following region: FIIKLIKWLMIAIPATFVNSAIRYLECKLALAFRTRLVDHAYETYFTNQT

Rabbit Polyclonal Anti-ABCD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCD2 Antibody: synthetic peptide directed towards the middle region of human ABCD2. Synthetic peptide located within the following region: WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT

Carrier-free (BSA/glycerol-free) ABCD2 mouse monoclonal antibody,clone OTI3B7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABCD2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 420-500 of human ABCD2 (NP_005155.1).
Modifications Unmodified

ABCD2 mouse monoclonal antibody,clone OTI3B7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABCD2 mouse monoclonal antibody,clone OTI3B7, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ABCD2 mouse monoclonal antibody,clone OTI3B7, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ABCD2 mouse monoclonal antibody,clone OTI3B7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated