Germany
Japan
United Kingdom
China
ABCD2 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family D (ALD), member 2 (ABCD2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, ABCD2 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family D (ALD), member 2 (ABCD2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ABCD2 (mGFP-tagged) - Human ATP-binding cassette, sub-family D (ALD), member 2 (ABCD2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Abcd2 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 2 (Abcd2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCD2 (GFP-tagged) - Human ATP-binding cassette, sub-family D (ALD), member 2 (ABCD2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, ABCD2 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family D (ALD), member 2 (ABCD2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ABCD2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN411199 is the updated version of KN211199.
Abcd2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500632 is the updated version of KN300632.
Abcd2 (GFP-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 2 (Abcd2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Abcd2 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 2 (Abcd2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abcd2 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 2 (Abcd2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Abcd2 (mGFP-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 2 (Abcd2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abcd2 (GFP-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 2 (Abcd2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, ABCD2 (mGFP-tagged) - Human ATP-binding cassette, sub-family D (ALD), member 2 (ABCD2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Abcd2 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family D (ALD), member 2 (Abcd2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Abcd2 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family D (ALD), member 2 (Abcd2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abcd2 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family D (ALD), member 2 (Abcd2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Abcd2 (mGFP-tagged ORF) - Rat ATP-binding cassette, sub-family D (ALD), member 2 (Abcd2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abcd2 (GFP-tagged ORF) - Rat ATP-binding cassette, sub-family D (ALD), member 2 (Abcd2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATP-binding cassette, sub-family D (ALD), member 2 (ABCD2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human ATP-binding cassette, sub-family D (ALD), member 2 (ABCD2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human ATP-binding cassette, sub-family D (ALD), member 2 (ABCD2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
ABCD2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of ATP-binding cassette, sub-family D (ALD), member 2 (ABCD2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human ATP-binding cassette, sub-family D (ALD), member 2 (ABCD2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Abcd2 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Abcd2 (untagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 2 (cDNA clone MGC:29110 IMAGE:5027149), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ABCD2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Purified recombinant protein of Human ATP-binding cassette, sub-family D (ALD), member 2 (ABCD2), Gly418-His506, with N-terminal His-ABP tag, expressed in E.coli, 50ug
| Tag | N-His ABP |
| Expression Host | E. coli |
ABCD2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 276~306 amino acids from the Central region of human ABCD2. |
Goat Anti-ABCD2 (aa460-473) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PLSDTLAIKGKVID, from the internal region of the protein sequence according to NP_005155.1. |
Rabbit Polyclonal Anti-ABCD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCD2 Antibody: synthetic peptide directed towards the N terminal of human ABCD2. Synthetic peptide located within the following region: FIIKLIKWLMIAIPATFVNSAIRYLECKLALAFRTRLVDHAYETYFTNQT |
Rabbit Polyclonal Anti-ABCD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCD2 Antibody: synthetic peptide directed towards the middle region of human ABCD2. Synthetic peptide located within the following region: WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT |
Carrier-free (BSA/glycerol-free) ABCD2 mouse monoclonal antibody,clone OTI3B7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ABCD2 CRISPRa kit - CRISPR gene activation of human ATP binding cassette subfamily D member 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Abcd2 CRISPRa kit - CRISPR gene activation of mouse ATP-binding cassette, sub-family D (ALD), member 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene ABCD2
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qSTAR qPCR primer pairs against Mus musculus gene Abcd2
Abcd2 (untagged ORF) - Rat ATP-binding cassette, sub-family D (ALD), member 2 (Abcd2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ABCD2 (untagged)-Human ATP-binding cassette, sub-family D (ALD), member 2 (ABCD2)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Abcd2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Abcd2 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-ABCD2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 274-288 amino acids of human ATP-binding cassette, sub-family D (ALD), member 2 |
ABCD2 mouse monoclonal antibody,clone OTI3B7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ABCD2 mouse monoclonal antibody,clone OTI3B7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ABCD2 mouse monoclonal antibody,clone OTI3B7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ABCD2 mouse monoclonal antibody,clone OTI3B7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ABCD2