Products

View as table Download

Rabbit Polyclonal Anti-ACAP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CENTB5 antibody: synthetic peptide directed towards the N terminal of human CENTB5. Synthetic peptide located within the following region: LQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGA

ACAP3 Antibody - Middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the Middle region of Human ACAP3