Germany
Japan
United Kingdom
China
ACAP3 (Myc-DDK-tagged)-Human ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (ACAP3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Acap3 (Myc-DDK-tagged) - Mouse ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (Acap3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACAP3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN421135 is the updated version of KN221135.
Acap3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500698 is the updated version of KN300698.
Acap3 (GFP-tagged) - Mouse centaurin, beta 5 (Centb5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Acap3 (Myc-DDK-tagged) - Mouse ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (Acap3)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acap3 (Myc-DDK-tagged) - Mouse ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (Acap3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Acap3 (mGFP-tagged) - Mouse ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (Acap3)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acap3 (GFP-tagged) - Mouse ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (Acap3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ACAP3 (Myc-DDK-tagged)-Human ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (ACAP3)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACAP3 (Myc-DDK-tagged)-Human ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (ACAP3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ACAP3 (mGFP-tagged)-Human ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (ACAP3)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACAP3 (mGFP-tagged)-Human ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (ACAP3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ACAP3 (GFP-tagged) - Human ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (ACAP3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Acap3 (Myc-DDK-tagged ORF) - Rat ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (Acap3), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Acap3 (Myc-DDK-tagged ORF) - Rat ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (Acap3), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acap3 (Myc-DDK-tagged ORF) - Rat ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (Acap3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Acap3 (mGFP-tagged ORF) - Rat ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (Acap3), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acap3 (GFP-tagged ORF) - Rat ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (Acap3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Acap3 (untagged) - Mouse ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (Acap3), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ACAP3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ACAP3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (ACAP3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-ACAP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CENTB5 antibody: synthetic peptide directed towards the N terminal of human CENTB5. Synthetic peptide located within the following region: LQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGA |
ACAP3 CRISPRa kit - CRISPR gene activation of human ArfGAP with coiled-coil, ankyrin repeat and PH domains 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene ACAP3
qPCR primer pairs and template standards against Mus musculus gene Centb5
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Acap3
Acap3 (untagged ORF) - Rat ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (Acap3), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of ArfGAP with coiled-coil ankyrin repeat and PH domains 3 (ACAP3) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
ACAP3 (untagged)-Human ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 (ACAP3)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SC310127 is the updated version of SC119108.
ACAP3 (untagged)-Human ArfGAP with coiled-coil ankyrin repeat and PH domains 3 (ACAP3)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Acap3 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Acap3 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ACAP3 Antibody - Middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the Middle region of Human ACAP3 |
Transient overexpression of ACAP3 (NM_030649) in HEK293T cells paraffin embedded controls for ICC/IHC staining
ACAP3 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
ACAP3 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Acap3 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Centb5 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Acap3 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Acap3 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
ACAP3 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Acap3 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vectorr
| Format | Retroviral plasmids |
| Vector | pRS |
Acap3 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of ACAP3 (NM_030649) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ACAP3 (NM_030649) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ACAP3