Products

View as table Download

Rabbit monoclonal antibody against CD13(clone EPR4058)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CD13 (ANPEP) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 880-930 of Human CD13.

Rabbit anti-ANPEP Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANPEP

Rabbit Polyclonal Anti-ANPEP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA

Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2

Goat Anti-CD13 / ANPEP Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated