Products

Antibodies (36)
cDNA Clones (22)
RNAi (12)
Gene Expression (7)
Proteins (6)
Assay Kits (2)
Jump to Filters
View as table Download
CD13 (ANPEP) (NM_001150) Human Recombinant Protein
TP308950

USD 823.00

In Stock

Purified recombinant protein of Homo sapiens alanyl (membrane) aminopeptidase (ANPEP)

Tag C-Myc/DDK
Expression Host HEK293T
CD13 (ANPEP) (NM_001150) Human Tagged ORF Clone
RC208950

USD 420.00

In Stock

ANPEP (Myc-DDK-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Anpep (NM_008486) Mouse Tagged ORF Clone
MR211336

USD 750.00

In Stock

Anpep (Myc-DDK-tagged) - Mouse alanyl (membrane) aminopeptidase (Anpep)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CD13 (ANPEP) (NM_001150) Human Tagged ORF Clone
RG208950

USD 460.00

In Stock

ANPEP (GFP-tagged) - Human alanyl (membrane) aminopeptidase (ANPEP)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Anpep Mouse Gene Knockout Kit (CRISPR)
KN501326

USD 1,290.00

2 Weeks

Anpep - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN501326 is the updated version of KN301326.
Anpep (NM_008486) Mouse Tagged ORF Clone
MG211336

USD 830.00

3 Weeks

Anpep (GFP-tagged) - Mouse alanyl (membrane) aminopeptidase (Anpep)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Anpep (NM_008486) Mouse Tagged ORF Clone Lentiviral Particle
MR211336L3V

USD 1,150.00

6 Weeks

Lenti ORF particles, Anpep (Myc-DDK-tagged) - Mouse alanyl (membrane) aminopeptidase (Anpep), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Anpep (NM_008486) Mouse Tagged ORF Clone
MR211336L4

USD 950.00

3 Weeks

Lenti ORF clone of Anpep (mGFP-tagged) - Mouse alanyl (membrane) aminopeptidase (Anpep)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Anpep (NM_008486) Mouse Tagged ORF Clone Lentiviral Particle
MR211336L4V

USD 1,150.00

6 Weeks

Lenti ORF particles, Anpep (GFP-tagged) - Mouse alanyl (membrane) aminopeptidase (Anpep), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD13 (ANPEP) (NM_001150) Human Tagged ORF Clone
RC208950L4

USD 620.00

3 Weeks

Lenti-ORF clone of ANPEP (mGFP-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Anpep (NM_031012) Rat Tagged ORF Clone
RR203468

USD 1,300.00

6 Weeks

Anpep (Myc-DDK-tagged ORF) - Rat alanyl (membrane) aminopeptidase (Anpep), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Anpep (NM_031012) Rat Tagged ORF Clone
RR203468L3

USD 1,480.00

10 Weeks

Lenti ORF clone of Anpep (Myc-DDK-tagged ORF) - Rat alanyl (membrane) aminopeptidase (Anpep), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Anpep (NM_031012) Rat Tagged ORF Clone Lentiviral Particle
RR203468L3V

USD 1,700.00

14 Weeks

Lenti ORF particles, Anpep (Myc-DDK-tagged ORF) - Rat alanyl (membrane) aminopeptidase (Anpep), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Anpep (NM_031012) Rat Tagged ORF Clone
RR203468L4

USD 1,630.00

10 Weeks

Lenti ORF clone of Anpep (mGFP-tagged ORF) - Rat alanyl (membrane) aminopeptidase (Anpep), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Anpep (NM_031012) Rat Tagged ORF Clone Lentiviral Particle
RR203468L4V

USD 1,900.00

14 Weeks

Lenti ORF particles, Anpep (GFP-tagged ORF) - Rat alanyl (membrane) aminopeptidase (Anpep), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD13 (ANPEP) Rabbit Monoclonal Antibody [Clone ID: EPR4058]
TA307568

USD 520.00

In Stock

Rabbit monoclonal antibody against CD13(clone EPR4058)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Anpep (NM_008486) Mouse Tagged ORF Clone
MR211336L3

USD 1,176.00

In Stock

Lenti ORF clone of Anpep (Myc-DDK-tagged) - Mouse alanyl (membrane) aminopeptidase (Anpep)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD13 (ANPEP) (NM_001150) Human Untagged Clone
SC119422

USD 310.00

In Stock

ANPEP (untagged)-Human alanyl (membrane) aminopeptidase (ANPEP)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC119422 is the updated version of SC125423.
CD13 (ANPEP) Rabbit Polyclonal Antibody
AP20647PU-N

USD 370.00

2 Weeks

CD13 (ANPEP) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 880-930 of Human CD13.
CD13 (ANPEP) Rabbit Polyclonal Antibody
TA332824

USD 275.00

3 Weeks

Rabbit anti-ANPEP Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANPEP
ANPEP Human shRNA Plasmid Kit (Locus ID 290)
TL314776

USD 815.00

In Stock

ANPEP - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
Anpep (NM_008486) Mouse Untagged Clone
MC200470

USD 210.00

In Stock

Anpep (untagged) - Mouse alanyl (membrane) aminopeptidase (Anpep), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Anpep Rat Monoclonal Antibody [Clone ID: ER-BMDM1]
TA363841

USD 600.00

2 Weeks

CD13 (dendritic cells, aminopeptidase), rat anti mouse, clone ER-BMDM1

Applications IHC
Reactivities Mouse, Human
Conjugation Unconjugated
ANPEP Human siRNA Oligo Duplex (Locus ID 290)
SR300203

USD 430.00

In Stock

ANPEP (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: B-F10]
AM31221RP-N

USD 300.00

2 Weeks

CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, PE

Applications FC
Reactivities Human
Conjugation PE
CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: WM15]
SM1070BT

USD 270.00

2 Weeks

CD13 (ANPEP) mouse monoclonal antibody, clone WM15, Biotin

Applications FC
Reactivities Human, Primate
Conjugation Biotin
CD13 (ANPEP) Rabbit Polyclonal Antibody
TA343101

USD 375.00

5 Days

Rabbit Polyclonal Anti-ANPEP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA
CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: B-F10]
AM31221AF-N

USD 270.00

2 Weeks

CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Azide Free

Applications FC
Reactivities Human
CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: B-F10]
AM31221FC-N

USD 280.00

2 Weeks

CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, FITC

Applications FC
Reactivities Human
Conjugation FITC
CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: B-F10]
AM31221PU-N

USD 250.00

2 Weeks

CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Purified

Applications FC
Reactivities Human
Human CD13/Aminopeptidase N ELISA Kit
EA100717

USD 470.00

3 Weeks

Human CD13/Aminopeptidase N ELISA Kit

Assay Type Sandwich ELISA kit of Quantitative Detection for Human CD13/Aminopeptidase N
Reactivities Human
CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: WM15]
SM1070AC

USD 300.00

2 Weeks

CD13 (ANPEP) mouse monoclonal antibody, clone WM15, APC

Applications FC
Reactivities Human, Primate
Conjugation APC
CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: WM15]
SM1070FC

USD 270.00

2 Weeks

CD13 (ANPEP) mouse monoclonal antibody, clone WM15, FITC

Applications FC
Reactivities Human, Primate
Conjugation FITC
CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: WM15]
SM1070RP

USD 300.00

2 Weeks

CD13 (ANPEP) mouse monoclonal antibody, clone WM15, PE

Applications FC
Reactivities Human, Primate
Conjugation PE
CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: WM-15 (WM15)]
TA320221

USD 185.00

5 Days

Mouse Anti-Human CD13 Purified (100 ug)

Applications FC
Reactivities Human
Conjugation Unconjugated
CD13 (ANPEP) Goat Polyclonal Antibody
TA329672

USD 375.00

5 Days

Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2
CD13 (ANPEP) Goat Polyclonal Antibody
TA329673

USD 375.00

5 Days

Goat Anti-CD13 / ANPEP Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2
CD13 (ANPEP) Human shRNA Lentiviral Particle (Locus ID 290)
TL314776V

USD 1,395.00

In Stock

ANPEP - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
ANPEP Human shRNA Plasmid Kit (Locus ID 290)
TR314776

USD 715.00

2 Weeks

ANPEP - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin
CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI2E4]
CF807395

USD 545.00

3 Days

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI2F10]
CF807396

USD 545.00

3 Days

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI3F8]
CF807397

USD 545.00

3 Days

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Mouse CD13/Aminopeptidase N ELISA Kit
EA100722

USD 470.00

3 Weeks

Mouse CD13/Aminopeptidase N ELISA Kit

Assay Type Sandwich ELISA kit of Quantitative Detection for Mouse CD13/Aminopeptidase N
Reactivities Mouse
Human CD13 (ANPEP) activation kit by CRISPRa
GA100202

USD 1,290.00

2 Weeks

ANPEP CRISPRa kit - CRISPR gene activation of human alanyl aminopeptidase, membrane

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Anpep activation kit by CRISPRa
GA202414

USD 1,290.00

2 Weeks

Anpep CRISPRa kit - CRISPR gene activation of mouse alanyl (membrane) aminopeptidase

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
CD13 (ANPEP) Human qPCR Template Standard (NM_001150)
HK200750

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene ANPEP

Application Plasmid of exact quantity for transcript copy number calculation