Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-CNDP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNDP1 antibody: synthetic peptide directed towards the C terminal of human CNDP1. Synthetic peptide located within the following region: GSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFA |
Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CNDP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CNDP1 |
CNDP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human CNDP1 (NP_116038.4). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Active filters
Target Symbol
- CNDP1
Applications
- WB