Products

View as table Download

Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH

Collagen I (COL1A1) rabbit polyclonal antibody, Biotin

Applications ELISA, FC, IHC, IP, WB
Reactivities Bovine, Human, Mammalian, Mouse, Rat
Conjugation Biotin
Immunogen Collagen Type I from Human and Bovine placenta.

Rabbit Anti-Collagen 1, alpha 1 telopeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 telopeptide conjugated to KLH

Collagen I mouse monoclonal antibody, clone 3G3, Purified from ascites by Protein A

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-COL1A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS

Collagen I (COL1A2) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to the N-terminus of Human COL1A2.

Collagen I (COL1A1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Collagen Type I from Human and Bovine Placenta

Rabbit Polyclonal Anti-COL1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: YRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMC

COL1A1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human COL1A1 (NP_000079.2).
Modifications Unmodified

COL1A1 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human COL1A1.
Modifications Unmodified

Collagen I alpha 1 Rabbit monoclonal Antibody

Applications IF, IP, WB
Reactivities Human
Conjugation Unconjugated