Germany
Japan
United Kingdom
China
COL1A1 (Myc-DDK-tagged)-Human collagen, type I, alpha 1 (COL1A1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
COL1A1 (untagged)-Human collagen, type I, alpha 1 (COL1A1)
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
COL1A1 (GFP-tagged) - Human collagen, type I, alpha 1 (COL1A1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Col1a1 (Myc-DDK-tagged) - Mouse collagen, type I, alpha 1 (Col1a1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 1,720.00
3 Weeks
Lenti ORF particles, COL1A1 (mGFP-tagged) - Human collagen, type I, alpha 1 (COL1A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 1,720.00
3 Weeks
Lenti ORF particles, COL1A1 (Myc-DDK tagged) - Human collagen, type I, alpha 1 (COL1A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
qSTAR qPCR primer pairs against Homo sapiens gene COL1A1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Col1a1 (GFP-tagged) - Mouse collagen type I alpha 1 (Col1a1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Col1a1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN503624 is the updated version of KN303624.
Lenti ORF clone of Human collagen, type I, alpha 1 (COL1A1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,720.00
5 Weeks
Lenti ORF particles, COL1A1 (Myc-DDK tagged) - Human collagen, type I, alpha 1 (COL1A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,720.00
3 Weeks
Lenti ORF particles, COL1A1 (mGFP-tagged) - Human collagen, type I, alpha 1 (COL1A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Col1a1 (Myc-DDK-tagged ORF) - Rat collagen, type I, alpha 1 (Col1a1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 525.00
5 Days
COL1A1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Human |
| Immunogen | Purified Collagen type I from Human skin. |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Porcine |
| Immunogen | Purified Collagen type I from Porcine tendon. |
Transient overexpression lysate of collagen, type I, alpha 1 (COL1A1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Collagen I (COL1A1) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, IF, IHC |
| Reactivities | Fish |
| Immunogen | Collagen Type I extracted and purified from salmon fish skin. |
Col1a1 rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Mouse |
| Immunogen | Purified Collagen type I from Mouse skin |
Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS |
Collagen type I human protein, 0.5 mg
| Protein Source | Placenta |
Purified recombinant protein of Human collagen, type I, alpha 1 (COL1A1), with N-terminal His tag, secretory expressed in HEK293 cells, 50ug
| Tag | N-His |
| Expression Host | HEK293 |
COL1A1 rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bovine |
| Immunogen | Purified Collagen type I from Bovine skin. |
qSTAR qPCR primer pairs against Mus musculus gene Col1a1
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bonito, Salmon, Sole, Tuna |
| Immunogen | Purified Collagen type I from Salmon skin |
Lenti ORF clone of Human collagen, type I, alpha 1 (COL1A1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human collagen, type I, alpha 1 (COL1A1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Col1a1 rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Mouse |
| Immunogen | Native type I Collagen from Mouse skin. |
Collagen I (COL1A1) (+ type III) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human, Porcine |
| Immunogen | Porcine Collagen, types 1 and 3 from skin |
Collagen I (COL1A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Collagen Type I from Human and Bovine Placenta |
Collagen I (COL1A1) mouse monoclonal antibody, clone NFI/20, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
USD 425.00
5 Days
Collagen I (COL1A1) (+ type II, III, IV, and V) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human |
| Immunogen | A mixture of human collagen 1-5 from human placenta. |
COL1A1 rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bovine |
| Immunogen | Purified Collagen type I from Bovine skin. |
Col1a1 rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Mouse |
| Immunogen | Purified Collagen type I from Mouse skin |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Fish, Goldfish |
| Immunogen | Purified collagen type I from goldfish skin |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bonito, Salmon, Sole, Tuna |
| Immunogen | Purified Collagen type I from Salmon skin |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bonito, Fish, Tuna |
| Immunogen | Purified Collagen type I from Tuna Fish skin |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bonito, Fish, Tuna |
| Immunogen | Purified Collagen type I from Tuna Fish skin |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Porcine |
| Immunogen | Purified Collagen type I from Porcine tendon. |
COL1A1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Collagen type I (Tail Tendon) mouse protein, 0.5 mg
Col1a1 (untagged) - Mouse collagen, type I, alpha 1 (Col1a1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of collagen type I alpha 1 (COL1A1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
COL1A1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Active filters
Target Symbol
- COL1A1