Products

View as table Download

COL1A1 (Myc-DDK-tagged)-Human collagen, type I, alpha 1 (COL1A1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH

COL1A1 (untagged)-Human collagen, type I, alpha 1 (COL1A1)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

Collagen I (COL1A1) rabbit polyclonal antibody, Biotin

Applications ELISA, FC, IHC, IP, WB
Reactivities Bovine, Human, Mammalian, Mouse, Rat
Conjugation Biotin
Immunogen Collagen Type I from Human and Bovine placenta.

COL1A1 (GFP-tagged) - Human collagen, type I, alpha 1 (COL1A1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Col1a1 (Myc-DDK-tagged) - Mouse collagen, type I, alpha 1 (Col1a1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Anti-Collagen 1, alpha 1 telopeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 telopeptide conjugated to KLH

qSTAR qPCR primer pairs against Homo sapiens gene COL1A1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

Col1a1 (GFP-tagged) - Mouse collagen type I alpha 1 (Col1a1), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Col1a1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN503624 is the updated version of KN303624.

Col1a1 (Myc-DDK-tagged ORF) - Rat collagen, type I, alpha 1 (Col1a1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Collagen I mouse monoclonal antibody, clone 3G3, Purified from ascites by Protein A

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

COL1A1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Human
Immunogen Purified Collagen type I from Human skin.

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Porcine
Immunogen Purified Collagen type I from Porcine tendon.

Collagen I (COL1A1) rabbit polyclonal antibody, Azide Free

Applications ELISA, IF, IHC
Reactivities Fish
Immunogen Collagen Type I extracted and purified from salmon fish skin.

Col1a1 rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Mouse
Immunogen Purified Collagen type I from Mouse skin

Rabbit Polyclonal Anti-COL1A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS

Collagen type I human protein, 0.5 mg

Protein Source Placenta

Purified recombinant protein of Human collagen, type I, alpha 1 (COL1A1), with N-terminal His tag, secretory expressed in HEK293 cells, 50ug

Tag N-His
Expression Host HEK293

COL1A1 rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Bovine
Immunogen Purified Collagen type I from Bovine skin.

qSTAR qPCR primer pairs against Mus musculus gene Col1a1

Collagen I (COL1A2) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to the N-terminus of Human COL1A2.

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Bonito, Salmon, Sole, Tuna
Immunogen Purified Collagen type I from Salmon skin

Lenti ORF clone of Human collagen, type I, alpha 1 (COL1A1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human collagen, type I, alpha 1 (COL1A1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Col1a1 rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Mouse
Immunogen Native type I Collagen from Mouse skin.

Collagen I (COL1A1) (+ type III) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC
Reactivities Human, Porcine
Immunogen Porcine Collagen, types 1 and 3 from skin

Collagen I (COL1A1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Collagen Type I from Human and Bovine Placenta

Collagen I (COL1A1) mouse monoclonal antibody, clone NFI/20, Purified

Applications ELISA, IHC
Reactivities Human

Collagen I (COL1A1) (+ type II, III, IV, and V) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC
Reactivities Human
Immunogen A mixture of human collagen 1-5 from human placenta.

COL1A1 rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Bovine
Immunogen Purified Collagen type I from Bovine skin.

Col1a1 rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Mouse
Immunogen Purified Collagen type I from Mouse skin

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Fish, Goldfish
Immunogen Purified collagen type I from goldfish skin

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Bonito, Salmon, Sole, Tuna
Immunogen Purified Collagen type I from Salmon skin

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Bonito, Fish, Tuna
Immunogen Purified Collagen type I from Tuna Fish skin

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Bonito, Fish, Tuna
Immunogen Purified Collagen type I from Tuna Fish skin

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Porcine
Immunogen Purified Collagen type I from Porcine tendon.

COL1A1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin

Collagen I (COL1A1) rabbit polyclonal antibody, Azide Free

Applications ELISA, IF, IHC
Reactivities Human
Immunogen Collagen I antibody was raised against human placental collagen Type I.

Collagen type I (Tail Tendon) mouse protein, 0.5 mg

Col1a1 (untagged) - Mouse collagen, type I, alpha 1 (Col1a1), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

3`UTR clone of collagen type I alpha 1 (COL1A1) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

COL1A1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100