Products

View as table Download

Rabbit Polyclonal Anti-CYP2C19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2C19 antibody: synthetic peptide directed towards the middle region of human CYP2C19. Synthetic peptide located within the following region: QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD

Rabbit Polyclonal Anti-Cytochrome P450 2C19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 2C19 Antibody: A synthesized peptide derived from human Cytochrome P450 2C19

Cytochrome p450 2C19 (CYP2C19) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 257-285 amino acids from the Central region of Human CYP2C19.