Products

Jump to Filters
View as table Download
DPPA2 Rabbit Polyclonal Antibody
TA340320

USD 375.00

5 Days

Rabbit Polyclonal Anti-DPPA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DPPA2 antibody: synthetic peptide directed towards the N terminal of human DPPA2. Synthetic peptide located within the following region: NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL
DPPA2 Mouse Monoclonal Antibody [Clone ID: OTI1G10]
CF800361

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DPPA2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)

Applications WB
Reactivities Human, Rat, Dog
Conjugation Unconjugated
DPPA2 Rabbit Polyclonal Antibody
TA375602

USD 220.00

3 Weeks

DPPA2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DPPA2 (NP_620170.3).
Modifications Unmodified
DPPA2 Mouse Monoclonal Antibody [Clone ID: OTI1G10]
TA800361

USD 379.00

In Stock

DPPA2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)

Applications WB
Reactivities Human, Rat, Dog
Conjugation Unconjugated
DPPA2 Mouse Monoclonal Antibody [Clone ID: OTI1G10]
TA800361S

USD 159.00

2 Days

DPPA2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)

Applications WB
Reactivities Human, Rat, Dog
Conjugation Unconjugated