Products

Jump to Filters
View as table Download
CDT2 (DTL) (Center) Rabbit Polyclonal Antibody
AP51328PU-N

USD 450.00

2 Weeks

CDT2 (DTL) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 229-256 amino acids from the Central region of Human DTL.
CDT2 (DTL) Rabbit Polyclonal Antibody
TA339337

USD 375.00

5 Days

Rabbit Polyclonal Anti-DTL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DTL antibody: synthetic peptide directed towards the N terminal of human DTL. Synthetic peptide located within the following region: VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV
CDT2 (DTL) Rabbit Polyclonal Antibody
TA375638

USD 220.00

3 Weeks

DTL Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 541-730 of human DTL (NP_057532.3).
Modifications Unmodified
CDT2 (DTL) Rabbit Polyclonal Antibody
TA384120

USD 380.00

4 Weeks

CDT2 Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human CDT2