Rabbit Polyclonal Anti-ELF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ELF1 Antibody: A synthesized peptide derived from human ELF1 |
Rabbit Polyclonal Anti-ELF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ELF1 Antibody: A synthesized peptide derived from human ELF1 |
Rabbit polyclonal anti-ELF1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ELF1. |
Rabbit Polyclonal anti-ELF1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ELF1 antibody: synthetic peptide directed towards the N terminal of human ELF1. Synthetic peptide located within the following region: VTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATT |
Goat Polyclonal Antibody against ELF1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-AMKQNELLEPNSF, from the C Terminus of the protein sequence according to NP_758961.1. |
Rabbit Polyclonal Anti-ELF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ELF1 antibody: synthetic peptide directed towards the middle region of human ELF1. Synthetic peptide located within the following region: RSSQLVAHPPGTVITSVIKTQETKTLTQEVEKKESEDHLKENTEKTEQQP |
Rabbit Polyclonal Anti-ELF1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ELF1 antibody: synthetic peptide directed towards the N terminal of mouse ELF1. Synthetic peptide located within the following region: DDIVAPITHVSVTLDGIPEVMETQQVQETNADSPGASSPEQRKRKKGRKT |
Carrier-free (BSA/glycerol-free) ELF1 mouse monoclonal antibody,clone OTI4F4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELF1 mouse monoclonal antibody,clone OTI3G7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELF1 mouse monoclonal antibody,clone OTI1H1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELF1 mouse monoclonal antibody,clone OTI2G9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELF1 mouse monoclonal antibody,clone OTI3D3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ELF1 mouse monoclonal antibody,clone OTI4F4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ELF1 mouse monoclonal antibody,clone OTI4F4, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ELF1 mouse monoclonal antibody,clone OTI4F4, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ELF1 mouse monoclonal antibody,clone OTI4F4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ELF1 mouse monoclonal antibody,clone OTI3G7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ELF1 mouse monoclonal antibody,clone OTI3G7, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ELF1 mouse monoclonal antibody,clone OTI3G7, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ELF1 mouse monoclonal antibody,clone OTI3G7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ELF1 mouse monoclonal antibody,clone OTI1H1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ELF1 mouse monoclonal antibody,clone OTI1H1, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ELF1 mouse monoclonal antibody,clone OTI1H1, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ELF1 mouse monoclonal antibody,clone OTI1H1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ELF1 mouse monoclonal antibody,clone OTI2G9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ELF1 mouse monoclonal antibody,clone OTI2G9, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ELF1 mouse monoclonal antibody,clone OTI2G9, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ELF1 mouse monoclonal antibody,clone OTI2G9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ELF1 mouse monoclonal antibody,clone OTI3D3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ELF1 mouse monoclonal antibody,clone OTI3D3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ELF1 mouse monoclonal antibody,clone OTI3D3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ELF1 mouse monoclonal antibody,clone OTI3D3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |